(data stored in ACNUC7421 zone)

EMBL: CP001630.PE344

CP001630.PE344       Location/Qualifiers
FT   CDS_pept        379013..379930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0349"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_4135 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34318"
FT                   /db_xref="GOA:C6WGK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34318.1"
FT                   /translation="MRRFLDRHWYAYAMVLPVVLVIAVLVLYPLAQGVFFTLTDINESS
FT                   IANPVLDRPATYEWVGLRNYLTVLSGDASYGAFWATLLRTVVWTASCVLLHYGIGLGLA
FT                   VLLNRQVAGRAVYRVLLILPWAVPAFISAFAWKYMFNAQYGIINQVLRALGLPDPVWLG
FT                   QSNWALVAVVIVNVWLGVPFMMVSLLGGLQSIPADLYEAAEVDGATPWQRFRHVTLPGL
FT                   RSVSSTVVLLGVIWTFNMFAVVYLITGQNPSTRLLITYAFERFFSGASRDYAVASTYGV
FT                   LILSVLLVFASGYRRALRRQGEVW"
     gtgcgcaggt tcctcgaccg gcactggtac gcgtacgcga tggtcctgcc ggtggtgctg        60
     gtcatcgccg tgctggtgct ctacccgctc gcgcaaggcg tgttcttcac cctcacggac       120
     atcaacgagt cgtccatcgc caacccggtg ctcgaccggc ctgccaccta cgagtgggtc       180
     ggcctgcgca actatctcac cgtgctctcc ggcgacgcca gctacggcgc gttctgggcc       240
     accctgctgc gcaccgtcgt gtggaccgcc agctgcgtgc tcctgcacta cggcatcggc       300
     ctcgggctcg ccgtcctgct caaccggcag gtcgccgggc gcgcggtcta ccgggtgctg       360
     ctgatcctgc cgtgggcggt gcccgcgttc atcagcgcgt tcgcctggaa gtacatgttc       420
     aacgcccagt acgggatcat caaccaggtc ctgcgcgccc tgggcctgcc cgacccggtg       480
     tggctcggcc agtcgaactg ggcgctggtc gccgtggtga tcgtgaacgt gtggctgggc       540
     gtgccgttca tgatggtctc gctgctcggc ggcctccagt ccatcccggc cgacctgtac       600
     gaggcggccg aggtcgacgg cgccaccccg tggcagcgct tccggcacgt caccctgccg       660
     ggcctgcgct cggtctccag cacggtcgtg ctgctgggcg tcatctggac gttcaacatg       720
     ttcgccgtcg tctacctgat caccggccag aacccgagca cccggctgct gatcacctac       780
     gcgttcgagc gcttcttctc cggcgcctcc cgcgactacg ccgtcgcctc cacctacggc       840
     gtgctcatcc tgtccgtcct gctcgtgttc gcgagcggct accggcgcgc gctgcgcagg       900
     caaggcgagg tgtggtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page