(data stored in ACNUC7421 zone)

EMBL: CP001630.PE345

CP001630.PE345       Location/Qualifiers
FT   CDS_pept        379930..380823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0350"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: acp:A2cp1_4287
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34319"
FT                   /db_xref="GOA:C6WGK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34319.1"
FT                   /translation="MSIEAASLRAATPARESRRAKRSRAASIGLHAALVTASLIAVFPV
FT                   FWVVVTSFKPDALAVETTPKLVNESSLDNYTRILSGEKGDFLAWFGNSVQIALLTTVLA
FT                   VFLSATAGYAASRFRFPGKRKLLLSFLVVQMFPFAVLIVPLYNTLLALGVQGTALGLVL
FT                   VYCTTAVPFCTYMLKGYFDTIPADIDEAGRVDGLSPFGVFWRLVLPLARPGLAVTSFYA
FT                   FLTAWGEVAFASAFLSAADESKTLAVGLQVFVQQNRTEWGHLAAASTLVAIPAVAVFYL
FT                   VQRFLVSGLAGGAVKG"
     atgtccatcg aggccgcttc gctgcgggcc gcgacgcccg cgcgcgagtc ccggagggcc        60
     aagcgctccc gcgccgcgtc gatcgggctg cacgccgccc tggtcaccgc gtcgctgatc       120
     gcggtgttcc cggtgttctg ggtcgtggtc acctcgttca agccggacgc gctggccgtc       180
     gagaccacgc ccaagctggt caacgagtcc agcctggaca actacacccg catcctgtcc       240
     ggggagaagg gcgacttcct ggcctggttc ggcaactcgg tgcagatcgc gctgctgacc       300
     acggtgctgg cggtgttcct gtcggccacc gccgggtacg cggccagccg cttccggttc       360
     cccggcaagc gcaagctgct gctgtcgttc ctggtcgtgc agatgttccc gttcgcggtg       420
     ctgatcgtgc cgctgtacaa caccctgctg gcgctgggcg tgcagggcac cgcgctcggc       480
     ctggtgctgg tctactgcac caccgccgtg ccgttctgca cctacatgct caagggctac       540
     ttcgacacca tccccgccga catcgacgag gcgggccggg tggacgggct ctcgccgttc       600
     ggcgtgttct ggcggctggt gctgccgctg gccaggccgg ggctcgcggt gacctcgttc       660
     tacgccttcc tgaccgcgtg gggcgaggtg gcgttcgcct cggcgttcct gtcggcggcc       720
     gacgagtcca agaccctcgc ggtgggcctg caggtgttcg tgcagcagaa ccgcaccgag       780
     tgggggcacc tggcggcggc gtccaccctg gtcgccatcc cggcggtcgc ggtgttctac       840
     ctcgtgcagc ggttcctggt ctcggggctg gcgggcggcg cggtgaaggg gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page