(data stored in ACNUC7421 zone)

EMBL: CP001630.PE346

CP001630.PE346       Location/Qualifiers
FT   CDS_pept        380907..382007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: rlt:Rleg2_5484
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34320"
FT                   /db_xref="GOA:C6WGK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34320.1"
FT                   /translation="MAEVAYDKASRIFSGNPPVRAVDELSLDVADGEFLVLVGPSGSGK
FT                   STALRMLAGLEDVDEGAIKIGGKDVTNVPPKGRDIAMVFQSYALYPHMTVAENMGFALK
FT                   LRKVAKEEIKQKVAEAAAMLDLTKYLDRKPKALSGGQRQRVAMGRAIVREPSVFLMDEP
FT                   LSNLDAKLRVETRANIAALQQRLGTTTIYVTHDQVEAMTMGHRVAVLKDGLLQQCDTPR
FT                   ALYDKPANAFVAGFMGSPAMNLKTVPLTAEGAKLDGLLVPLERTKLDAASGKGLSEVVF
FT                   GVRPESLALVGDGEPGMEMAVELVEELGADALLHGAVRIGDSSERFVVRVDGRTPPALG
FT                   QTVKVGVRDASEVHLFHPETGLRLTD"
     atggcagagg tcgcctacga caaggcgtcg cggatcttct ccggcaaccc cccggtgcga        60
     gccgtcgacg agttgtccct cgacgtggcg gacggcgagt tcctggttct ggtcggcccg       120
     tcgggttccg gcaagtccac cgccctgcgg atgctcgcgg gcctggagga cgtcgacgag       180
     ggcgccatca agatcggcgg caaggacgtc accaacgtgc cgccgaaggg ccgggacatc       240
     gcgatggtgt tccagtccta cgcgctgtac ccgcacatga cggtcgcgga gaacatgggc       300
     ttcgcgctca agctgcgcaa ggtcgccaag gaggagatca agcagaaggt cgccgaggcg       360
     gcggccatgc tcgacctcac caagtacctg gaccgcaagc cgaaggcgct ctccggcggt       420
     cagcgccagc gcgtcgcgat gggccgcgcg atcgtccgcg agcccagcgt gttcctcatg       480
     gacgagccgc tgtccaacct ggacgccaag ctccgcgtcg agacccgcgc gaacatcgcg       540
     gccctccagc agcgcctggg caccaccacg atctacgtca cgcacgacca ggtcgaggcc       600
     atgaccatgg gccaccgggt cgccgtgctc aaggacggcc tgctccagca gtgcgacacc       660
     ccgcgcgcgc tgtacgacaa gcctgccaac gcgttcgtcg cgggcttcat gggctcgccc       720
     gccatgaacc tgaagaccgt gccgctgacc gccgagggcg cgaagctgga cggcctgctg       780
     gtgccgctgg agcgcaccaa gctcgacgcc gcctccggca agggcctgtc cgaggtcgtc       840
     ttcggcgtgc gccccgagtc gctggcgctg gtcggcgatg gcgagccggg catggagatg       900
     gccgtcgagc tggtcgagga gctgggcgcg gacgcgctgc tgcacggcgc ggtccgcatc       960
     ggcgactcct ccgagcggtt cgtggtccgc gtcgacggcc gcaccccgcc cgcgctgggc      1020
     cagaccgtca aggtcggcgt gcgcgacgcc tccgaggtgc acctgttcca cccggagacc      1080
     gggctgcgcc tgaccgactg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page