(data stored in ACNUC7421 zone)

EMBL: CP001630.PE347

CP001630.PE347       Location/Qualifiers
FT   CDS_pept        382167..383057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0352"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bpy:Bphyt_0292 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34321"
FT                   /db_xref="GOA:C6WGK5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK5"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACU34321.1"
FT                   /translation="MTVRTTLITAVAVLGLTTACGSADQGGSGSSDAPAGAVPVVTSTN
FT                   VWGSVVKAVGGDAVQVKALIDDPSADPHSFESKPADIAAVADAKLVVGNGGGYDDFFDK
FT                   IVDESARSAKRVDAFALSGKEENEHVWYDLATVRKVADKVAEELSAIAPDKKDAFTKGA
FT                   ADFGTALDGLTAKAERIKPAKVVVTEPVPAYLLETAGVEDLTPAEFTEAIENETDVPVA
FT                   AIAATGDLIVNKQVNALINNTQTENAVTGDLVAKAGTAGLPVVGMTETLPEGVTGYVEW
FT                   MTKQVDELTAALGTK"
     atgactgtgc gcaccacgct gatcaccgcc gtggcggtgc tcggtctcac caccgcctgc        60
     ggcagcgccg accagggcgg aagcggctcc tccgacgccc ccgccggcgc ggtccccgtc       120
     gtcacctcca ccaacgtgtg gggcagcgtc gtcaaggcgg tcggcgggga cgccgtccag       180
     gtcaaggccc tgatcgacga cccgtccgcc gacccgcact cgttcgagag caagcccgcc       240
     gacatcgccg cggtcgcgga cgccaagctc gtcgtcggca acggcggcgg ctacgacgac       300
     ttcttcgaca agatcgtcga cgagtccgcc cggtcggcca agcgcgtcga cgccttcgcc       360
     ctctcgggca aggaggagaa cgagcacgtc tggtacgacc tggccaccgt ccgcaaggtc       420
     gccgacaagg tcgccgagga gctctccgcg atcgccccgg acaagaagga cgccttcacc       480
     aagggcgcgg ccgacttcgg cacggcgctc gacggcctca ccgccaaggc ggagcggatc       540
     aagcccgcca aggtcgtcgt gaccgagccg gtgcccgcct acctgctgga gaccgcggga       600
     gtcgaggacc tcaccccggc cgagttcacc gaggccatcg agaacgagac cgacgtcccc       660
     gtcgccgcca tcgccgccac cggtgacctg atcgtgaaca agcaggtcaa cgcgctgatc       720
     aacaacaccc agacggagaa cgcggtcacg ggcgacctgg tcgccaaggc cgggaccgcc       780
     gggctgcccg tcgtggggat gaccgagacg ctgccggaag gcgtcacggg ttacgttgag       840
     tggatgacga agcaggtcga cgagctgacc gccgcgctcg ggacgaaatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page