(data stored in ACNUC7421 zone)

EMBL: CP001630.PE348

CP001630.PE348       Location/Qualifiers
FT   CDS_pept        383054..383896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bvi:Bcep1808_2715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34322"
FT                   /db_xref="GOA:C6WGK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34322.1"
FT                   /translation="MSAQTTTPDRPAAQRGAVSLRSARLAYGDRVLWDGLDLDVRPGEF
FT                   IAVLGPNGSGKTSLMRVLLGLQPLSGGSVEIAGVPAGRGSRAIGYIPQQRPVDTSTVLR
FT                   GRDLVGLGLDGHRWGLGLRGRAERRRRVDEVLEAVGATAYADRPVGLLSGGEQQRLRVA
FT                   QALVGDPAVLLCDEPLLSLDLAHQRVVSDLINTRRRASDTAVLFVTHEINPVLPLVDRV
FT                   LYLVDGRFRIGSPAEVMTGETLSELYRTTVEVVRVRGQIHVVGAHGVCEDQPHHAEER"
     atgagcgccc agaccaccac gcctgaccgc cccgcagccc agcgcggggc ggtctcgctg        60
     cgttcggccc ggctcgcgta cggcgaccgg gtcctctggg acggactgga cctcgacgtc       120
     cggccgggcg agttcatcgc ggtcctcggc cccaacgggt ccggcaagac cagcctgatg       180
     cgggtcctgc tgggcctgca gcccctctcc ggcggcagcg tcgagatcgc gggcgtcccg       240
     gccgggcgcg gcagccgcgc catcggctac atcccccagc agcgccccgt ggacacctcc       300
     accgtgctgc gcgggcgcga cctcgtcggc ctcgggctcg acggccaccg ctggggcctc       360
     ggcctgcgcg ggcgcgccga gcgccgccgc cgcgtcgacg aggtcctgga ggccgtcggc       420
     gccaccgcct acgccgaccg gcccgtcggc ctgctctccg gcggcgagca gcagcggctg       480
     cgcgtcgcgc aggccctcgt cggcgacccg gccgtgctgc tgtgcgacga gccgctcctc       540
     tcgctcgacc tcgcccacca gcgcgtcgtc agcgacctca tcaacacccg gcggcgcgcc       600
     tcggacaccg ccgtcctgtt cgtcacccac gagatcaacc cggtgctccc gctggtcgac       660
     cgcgtcctct acctggtcga cggccgcttc cggatcggct cacccgccga ggtcatgacc       720
     ggcgagaccc tgtccgagct gtaccgcacc accgtcgagg tggtcagggt gcgcggccag       780
     atccacgtcg tcggcgcgca cggcgtgtgc gaggaccagc cgcaccacgc cgaggagcgc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page