(data stored in ACNUC7421 zone)

EMBL: CP001630.PE349

CP001630.PE349       Location/Qualifiers
FT   CDS_pept        383896..384732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0354"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: bxe:Bxe_A0715 ABC
FT                   Mn2+/Zn2+ transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34323"
FT                   /db_xref="GOA:C6WGK7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK7"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACU34323.1"
FT                   /translation="MESLFDFATTADLIGLPVVQRALLAAAVLGLVAGAIGPLVITRKM
FT                   SFAVHGTSELAFTGGAAALLLGISVSYGAVLGAVVAALLLGLLGQRDSERDSVIGAVLA
FT                   FGLGLGVLFLWLYPGRAANKMGLLVGQPIGIPAGDVQVLVVCAVVVLVVLALLYRPLLF
FT                   ASVDPDVALARGVPVRALSPVFAVLVGITTALGVQIVGALLVLSMMITPAAAAARITAS
FT                   PAKATVLAIVFAEVAVLGGIVLSLAPGVPVSAFVTAISFAIYVICRIVGKSRVRAV"
     atggagagcc tgttcgactt cgccacgacc gccgacctga tcggcctgcc ggtcgtgcag        60
     cgcgcgctcc tggccgccgc cgtcctcggc ctggtcgccg gggccatcgg cccgctggtg       120
     atcacccgga agatgtcctt cgcggtccac ggcaccagcg agctggcctt caccggcggc       180
     gccgccgccc tgctgctcgg catcagcgtc agctacggcg cggtgctcgg cgccgtcgtc       240
     gccgccctgc tgctcggcct gctcggccag cgcgactccg agcgcgactc ggtcatcggc       300
     gcggtgctcg ccttcggcct gggcctcggc gtgctgttcc tgtggctcta ccccggccgc       360
     gcggccaaca agatgggcct gctcgtcggc cagcccatcg gcatccccgc cggtgacgtg       420
     caggtgctgg tggtctgcgc cgtcgtcgtg ctggtggtcc tcgcgctgct gtaccggccg       480
     ctgctgttcg ccagcgtcga cccggacgtg gcgctcgcca ggggcgtccc ggtgcgcgcg       540
     ctgtccccgg tgttcgcggt cctggtcggc atcaccaccg cgctcggcgt gcagatcgtg       600
     ggcgcgctgc tcgtgctctc catgatgatc acgcccgccg ccgctgccgc gcggatcacc       660
     gcgagcccgg ccaaggccac cgtgctcgcg atcgtgttcg ccgaggtcgc cgtgctcggc       720
     ggcatcgtgc tctcgctcgc gcccggcgtg ccggtgagcg cattcgtcac cgcgatttcg       780
     ttcgccattt acgtgatctg ccggatcgtc gggaaatcac gcgttcgggc tgtttga          837
//

If you have problems or comments...

PBIL Back to PBIL home page