(data stored in ACNUC7421 zone)

EMBL: CP001630.PE35

CP001630.PE35        Location/Qualifiers
FT   CDS_pept        39176..39943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0035"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34009"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34009.1"
FT                   /translation="MRVLVTGASQGIGAAVAERFAAQGAEVHLVARGAVALAAVVERIT
FT                   ARGGRAVAHVADLADERRVLALAEEVGPVDVLVNNAGVGRWLFLDDTAPDELRGMTALP
FT                   YASYALLTSLLLPAMRERGSGRLVFLNSPASRIAIPGATGYTAARWAVRGLVAALRQDL
FT                   RGTGVGVTEVVPGAVRSNYFDNNPGSAERIPWVVSRLVPTMTPERVAAEVVKAVARGRS
FT                   EVVFPWQIKLFDLVGRVIPGAVAYLAWRTGVHR"
     atgagggttc tggtgaccgg ggcgtcccag gggatcgggg cggccgtcgc cgagcggttc        60
     gccgcccagg gcgccgaggt gcacctggtg gcgcgcgggg cggtcgcgct cgcggccgtg       120
     gtcgagcgga tcaccgcgcg cggcgggcgg gcggtggcgc acgtcgccga cctcgccgac       180
     gagcggcggg tgctcgcgct ggcggaggag gtcgggccgg tcgacgtgct ggtcaacaac       240
     gcgggcgtcg gccgctggct gttcctggac gacaccgcgc ccgacgagct gcgcggcatg       300
     accgccctgc cgtacgcctc gtacgcgctg ctcacctcgc tgctgctgcc cgccatgcgc       360
     gagcgcggct cgggtcggct ggtgttcctg aactcgcccg cctcgcggat cgccatcccc       420
     ggagccaccg gctacacggc ggcgcgctgg gcggtgcgcg ggctggtcgc cgcgctgcgc       480
     caggacctgc ggggcaccgg ggtcggcgtc acggaggtcg tgccgggcgc ggtgcggtcc       540
     aactacttcg acaacaaccc cggttcggcc gagcgcatcc cgtgggtcgt cagcaggctc       600
     gtccccacga tgacccccga acgggtggct gccgaagtgg tgaaggccgt ggcccgggga       660
     cgctccgaag tcgttttccc gtggcagatc aaactcttcg acctggtcgg aagggtgatt       720
     cctggagctg tcgcatatct cgcctggcgg accggcgttc acaggtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page