(data stored in ACNUC7421 zone)

EMBL: CP001630.PE350

CP001630.PE350       Location/Qualifiers
FT   CDS_pept        complement(384876..386333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0355"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: cvi:CV_3252 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34324"
FT                   /db_xref="GOA:C6WGK8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU34324.1"
FT                   /translation="MANSLPDHEPPTTPGVSAGRNWELWSLRPAAIAYILSLELVVLIS
FT                   TIWLMAGVGSASESDWFRFGAFAAAVTVHLTIVRRAEESRRDESASLYFDLTSVWTFAA
FT                   AVVLPAPLAVLIVLLLRVVTQPIARRQPYRFVFTSTHIVASTVLAGVAVREAGFPLLAT
FT                   GRVLGDLGLLAVLALTAALYWFTQVVLMTGVLKILNPRTRFADTLGSRGDNMLEATTLG
FT                   VGALLGLLTATHWAAPLLMVVPVVLANALLHRASERQAHLERLLAEQAQAHQQLTQDAH
FT                   TDFRTGLLNTTGLAEFAHRLAERGRIDGKPVTVLAIDLDHFKRINDTWGHPAGNAVLAE
FT                   VGRILREKLRPGDVAGRDGGEEFVVVLADTGLAEGTAIAERVREAIGLMVVVTTDKHRS
FT                   TVHLRGRDLPVNEDGQEVRAISASIGVAVLGEGPDALAHAQHSADAALYAAKERGRNQV
FT                   RVANVDIGGPRPAALARLQDHGVPRTA"
     gtggcgaaca gtttgcccga tcacgaaccg cccacgacac cgggcgtgtc cgccgggcgg        60
     aactgggagc tctggtccct gcgaccggcc gcgatcgctt acatcctttc cctcgaattg       120
     gtggtgttga tttccaccat ttggttgatg gccggggtgg gatccgcctc cgagtccgac       180
     tggttccggt tcggggcgtt cgcggcggcc gtgacggtgc acctgacgat cgtccggcgg       240
     gccgaggagt cgcggcggga cgagtccgcg agcctgtact tcgacctcac ctcggtgtgg       300
     acgttcgccg cggcggtggt gctgcccgcg ccgctggcgg tgctgatcgt gctgctgctg       360
     cgcgtggtca cccagccgat cgcgcgacgg cagccctacc ggttcgtgtt cacctcgacg       420
     cacatcgtgg ccagcacggt gctggccggg gtcgcggtgc gcgaggcggg cttcccgctg       480
     ctggccaccg gccgggtgct gggcgacctg gggctgctgg cggtgctggc gctgaccgcc       540
     gcgctgtact ggttcaccca ggtggtgctg atgacgggcg tgctgaagat cctgaacccg       600
     cgcacccggt tcgcggacac gctgggctcg cgcggggaca acatgctgga ggccaccacg       660
     ctgggcgtgg gcgcgctgct cgggctgctg accgcgacgc actgggccgc gccgctgctg       720
     atggtggtgc cggtggtgct ggcgaacgcg ctgctgcacc gggcgtcgga gcggcaggcg       780
     cacctggagc ggctgctggc cgagcaggcg caggcgcacc agcagctcac ccaggacgcg       840
     cacaccgact tccgcacggg cctgctgaac acgaccgggc tcgccgagtt cgcgcaccgg       900
     ctggccgagc ggggccgcat cgacggcaag ccggtgaccg tgctggcgat cgacctggac       960
     cacttcaagc ggatcaacga cacctggggg cacccggcgg gcaacgcggt gctggccgag      1020
     gtggggcgca tcctgcggga gaagctgcgg ccgggcgacg tggccggtcg ggacggcggc      1080
     gaggagttcg tggtcgtgct ggccgacacc gggctggccg agggcacggc gatcgcggag      1140
     cgggtgcggg aggcgatcgg gctgatggtg gtggtgacca ccgacaagca ccgcagcacg      1200
     gtgcacctgc gcggccggga cctgccggtg aacgaggacg ggcaggaggt gcgggcgatc      1260
     tcggcgtcga tcggggtcgc ggtgctgggc gagggcccgg acgcgctggc gcacgcgcag      1320
     cacagcgccg acgcggcgct gtacgcggcg aaggagcggg gccgcaacca ggtgcgggtg      1380
     gcgaacgtgg acatcggcgg gccgcgcccg gcggcgctgg cccggttgca ggaccacggg      1440
     gtgccgcgca cggcctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page