(data stored in ACNUC7421 zone)

EMBL: CP001630.PE351

CP001630.PE351       Location/Qualifiers
FT   CDS_pept        complement(386565..387788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0356"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reh:H16_B2569 putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34325"
FT                   /db_xref="GOA:C6WGK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34325.1"
FT                   /translation="MTSGGALRALVGNREFRGLWIGSVVSTAGDQLAAVALSLLVFERT
FT                   GSPAWTAVTWASTLLPPLVSGPLLAWVADRHPRRTVMVTCAWLQAALVGAMALPGVPLW
FT                   GMVALLFSALMVASPFLAAQEASLPSVLPDERYDDGVALFGTSVDVAQMVGLAAAGFLV
FT                   TWAGPGAALALDAASFVLVAVLVQLSVEHRPAAAPRSAPEDPEGARSALALLLTEPRLR
FT                   SLLGMRLLAGLAMVPEGLAVPLADGLGAVWAVGLILAVEPAANVLGVALLFRFVRDPRQ
FT                   RERLMGPLAVLSLAPLALFALEPNLTWAIVLLVIAGMAGAYHTPARAAWMRLLPDAYRG
FT                   RAFGIARTALRTSQGGGMALAGVVAHAVGSVTATIAGAGGVGLLLAAQATVAWRRARAK
FT                   AGPDAVTT"
     gtgacctccg ggggcgcgct gcgcgccctg gtgggcaacc gcgagttccg cgggctgtgg        60
     atcggttcgg tcgtgtccac ggcgggcgac cagctcgccg cggtggcgct gtccctgctg       120
     gtgttcgagc gcaccggctc ccccgcgtgg accgccgtga cctgggcgtc cacgctgctg       180
     ccgccgctgg tgtccggccc gctgctggcc tgggtcgccg accgccaccc ccgccgcacc       240
     gtgatggtga cgtgcgcctg gctccaagcc gcgctggtgg gcgcgatggc cctgcccggc       300
     gtgccgctgt ggggcatggt cgcgctgctc ttctccgccc tcatggtcgc ctccccgttc       360
     ctggccgccc aggaggcgag cctgccctcg gtgctgcccg acgagcgcta cgacgacggg       420
     gtggcgctgt tcgggacctc cgtggacgtc gcccagatgg tggggctcgc cgccgcgggc       480
     ttcctggtga cctgggccgg tcccggcgcc gcgctggcgc tggacgccgc gagcttcgtg       540
     ctggtcgcgg tgctggtgca actgtccgtc gagcaccggc ccgccgccgc gccgcgcagc       600
     gcccccgagg acccggaggg ggcgcggagc gcgctggcgc tgctgctgac cgagccccgg       660
     ctgcgctcgc tgctggggat gcggctgctg gccggcctgg cgatggtgcc ggaggggctg       720
     gcggtgccgc tggccgacgg gctgggcgcg gtgtgggcgg tcgggctgat cctggccgtg       780
     gagcccgccg cgaacgtgct gggcgtggcc ctgctgttcc gcttcgtgcg cgacccccgg       840
     cagcgggagc ggctgatggg gccgctggcg gtgctgtcgc tggcgccgct ggcgctgttc       900
     gcgctggagc cgaacctgac ctgggcgatc gtgctgctgg tcatcgcggg catggccggg       960
     gcgtaccaca cgcccgcgcg ggcggcctgg atgcggctgc tgcccgacgc ctaccggggc      1020
     cgggcgttcg gcatcgcgcg caccgccctg cgcaccagcc agggcggtgg catggcgctc      1080
     gcgggcgtcg tggcgcacgc tgttggctcg gtgaccgcga cgatcgcggg cgcgggcggt      1140
     gtcgggctgc tgctcgccgc gcaggcgacc gtagcctgga ggagggcccg cgcgaaggcg      1200
     ggccccgatg cggtgaccac gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page