(data stored in ACNUC7421 zone)

EMBL: CP001630.PE352

CP001630.PE352       Location/Qualifiers
FT   CDS_pept        388223..388399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34326.1"
FT                   /translation="MGRAEQWGSRGVSAEELVARHRALPKVDYELMRRETDEFFGTEDR
FT                   IGDGDDPWERTRG"
     gtgggacgcg ccgagcagtg gggatcgcgg ggcgtcagcg ccgaggagct ggtcgcccgg        60
     caccgcgcgc tgcccaaggt ggactacgag ctcatgaggc gcgagaccga cgagttcttc       120
     ggcaccgagg accgcatcgg tgacggcgac gacccgtggg agcgcacccg tggctga          177
//

If you have problems or comments...

PBIL Back to PBIL home page