(data stored in ACNUC7421 zone)

EMBL: CP001630.PE353

CP001630.PE353       Location/Qualifiers
FT   CDS_pept        complement(388670..390100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0358"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: ppw:PputW619_0881 membrane bound O-acyl
FT                   transferase MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34327"
FT                   /db_xref="GOA:C6WGL1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL1"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ACU34327.1"
FT                   /translation="MSFATPLFLWFFVPAVLTAVLVAPRGWRNGIVAVASLLFYVTGAG
FT                   GTTLLLLACMVVNYLAGLRLAPDGPLAADKRRVLLVGVIGFDLAVLLVWKYLGFATEQL
FT                   AAIASIVGADLPVVHLALPIGISFYTFHHISYVVDVYRGERPALREPVSFITYIAMFPQ
FT                   LVAGPIVRWREIADQLPQERTHRLDDIAAGFPRFALGLCKKVIVADSLAPLVDAAFATP
FT                   SDEMTWSVAWLGAIGYALQLYFDFSGYSDMAIGLGRMLGFRLPENFARPYSSVTITEFW
FT                   RRWHMSLSRWFRDYLYIPLGGNRRGTWTTYRNLSIVFVLTGFWHGANWTFLVWGVFHGA
FT                   LLIVERRFGWAEAPQGPKALLGRRALTFLLVVVGWVFFRSPDLGTAFSVLGNMLVPDFD
FT                   GLPDAVAVAATNQRIALLVLALVVVLLPNHPVTGPYLESARTRVATGLRVAVMTVGALY
FT                   AAILVAGGTFSPFLYYQF"
     atgtccttcg ccacgccgct cttcctctgg ttcttcgtgc cggccgtgct cacggccgtc        60
     ctcgtcgcgc ccaggggctg gcgcaacggg atcgtcgcgg tggccagcct gctgttctac       120
     gtgacgggcg cgggcggcac gacgctgctg ctgctcgcct gcatggtggt gaactacctc       180
     gcggggctga ggctggcccc ggacgggccg ctggcggccg acaagcggcg ggtgctgctg       240
     gtcggggtga tcggcttcga cctggccgtg ctgctggtgt ggaagtacct ggggttcgcg       300
     accgagcagc tggcggcgat cgcctcgatc gtgggcgcgg acctgccggt ggtgcacctg       360
     gcgctgccga tcggcatctc gttctacacg ttccaccaca tctcgtacgt ggtggacgtg       420
     taccggggcg agcggcccgc gctgcgcgag ccggtctcgt tcatcaccta catcgcgatg       480
     ttcccgcagc tcgtggcggg tccgatcgtg cggtggcggg agatcgccga ccagctcccg       540
     caggagcgca cgcaccggct ggacgacatc gcggcggggt tcccccggtt cgcgctgggg       600
     ttgtgcaaga aggtcatcgt cgctgactcg ctggcgcccc tggtggacgc cgcgttcgcc       660
     acgccctcgg acgagatgac ctggtcggtg gcgtggctgg gcgcgatcgg ttacgcgctg       720
     cagctgtact tcgacttctc cgggtactcg gacatggcga tcgggctcgg gcggatgctg       780
     ggtttccggc tgccggagaa cttcgcgcgg ccgtactcgt cggtgacgat caccgagttc       840
     tggcggcggt ggcacatgtc gctgtcgcgg tggttccggg actacctgta catcccgctc       900
     ggcggcaacc gccgggggac gtggacgacg taccggaacc tgtcgatcgt gttcgtgctg       960
     accgggttct ggcacggggc gaactggacg ttcctggtgt ggggcgtgtt ccacggggcg      1020
     ctgctgatcg tggagcggcg gttcgggtgg gccgaggcgc cgcaggggcc caaggcgctg      1080
     ctgggccggc gggcgctgac gttcctgctg gtcgtggtgg gctgggtgtt cttccggtcg      1140
     ccggacctgg gcacggcgtt ctcggtgctg gggaacatgc tggtcccgga cttcgacggc      1200
     ctgccggacg cggtggcggt ggcggcgacg aaccagcgga tcgcgctgct ggtgctggcg      1260
     ctggtcgtgg tgctcctgcc gaaccacccg gtgacggggc cgtacctgga gtcggcgcgc      1320
     acgcgggtcg cgacggggct gcgggtcgcg gtgatgacgg tgggcgcgct gtacgcggcg      1380
     atcctggtgg cgggcgggac cttcagcccg ttcctgtact accagttctg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page