(data stored in ACNUC7421 zone)

EMBL: CP001630.PE354

CP001630.PE354       Location/Qualifiers
FT   CDS_pept        complement(390193..391158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0359"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: afw:Anae109_2230
FT                   RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34328"
FT                   /db_xref="GOA:C6WGL2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL2"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACU34328.1"
FT                   /translation="MAGNSKRRGAMRTPGSKKGAVVGSGGQKSKGLQGKGPTPKAQDRP
FT                   NHPAYRKANAAAKANAVRQQRRKAADAAPETVAGRNPVVECLRAGIPATALYVALGIDA
FT                   DDRVAEAVQLAASRGISVLEVQRGELDRITGGAMHQGLGLQVPPYEYAEPRDLLRAAKE
FT                   SGRPPLLVALDGVTDPRNLGAVVRSAAAFGAHGVVLPQRRSASMTAVAWRTSAGTAARL
FT                   PIAVATNLTRQLREWAEAGLMVIGLDADGDVDVDGLDLATGPLVVVVGSEGRGLSRLVR
FT                   ETCDQTVSIPMASNVESLNASVAAGVVLAEVARRRRLDAR"
     gtggcaggga actccaagcg ccggggggcg atgcgcaccc ccggttccaa gaagggcgcg        60
     gtcgtcggtt ccggcggtca gaagtccaag ggtctgcagg gcaagggccc gacccccaag       120
     gcgcaggacc ggccgaacca cccggcctac cgcaaggcga acgcggcggc caaggccaac       180
     gcggtgcgcc agcagcggcg caaggccgcc gacgccgcgc cggagacggt cgcgggccgc       240
     aacccggtcg tggagtgcct gcgcgcgggc atcccggcga cggcgctgta cgtggcgctg       300
     ggcatcgacg cggacgaccg cgtcgccgag gcggtgcagc tggcggcgag ccggggcatc       360
     tccgtgctgg aggtgcagcg cggcgagctg gaccggatca ccggcggcgc gatgcaccag       420
     ggcctcggcc tccaggtgcc gccgtacgag tacgcggagc cgcgcgacct gctcagggcc       480
     gcgaaggagt cgggccgccc gccgctgctg gtggcgctgg acggggtcac cgacccgcgc       540
     aacctgggcg ccgtggtgcg ctcggcggcg gcgttcggcg cgcacggcgt ggtgctgccg       600
     cagcggcgct cggcgagcat gacggccgtg gcgtggcgga ccagcgcggg cacggcggcg       660
     cggctgccga tcgcggtggc cacgaacctg acccggcagc tgcgcgagtg ggccgaggcc       720
     gggttgatgg tcatcggcct cgacgcggac ggcgacgtgg acgtggacgg cctggacctg       780
     gcgacgggcc cgctggtcgt ggtggtgggc tccgagggcc gggggctgtc ccggctggtg       840
     cgggagacct gcgaccagac cgtgtcgatc ccgatggcgt cgaacgtgga gtcgctgaac       900
     gcgtcggtcg cggcgggcgt cgtgctcgcc gaggtcgcgc gcaggcgcag gctggacgcc       960
     cgctag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page