(data stored in ACNUC7421 zone)

EMBL: CP001630.PE355

CP001630.PE355       Location/Qualifiers
FT   CDS_pept        complement(391164..392558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0360"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: aeh:Mlg_1810 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34329"
FT                   /db_xref="GOA:C6WGL3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL3"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACU34329.1"
FT                   /translation="MSLHIYDTASRELREFRPQISGTASIYVCGATVQGVPHIGHVRSG
FT                   LNFDVLRRWLARTHERVVLVRNVTDIDDKILVKSAQHDRTWWDWAFEHERAFDDAYEAL
FT                   GCLPPTYAPRATGHVTQMVELMRRLIDAGHAYAANGDVYFSVSSFPEYGKLSGQRVDEV
FT                   QQGESELTGKRDPRDFTLWKAAKPGEPSWPTPWGDGRPGWHLECSAMATEYLGSTFDVH
FT                   GGGIDLIFPHHENEQAQSRAVGDGFARYWMHNAWVTLSGEKMSKSLGNTVSIPAMLEQV
FT                   RAPELRYYLVGPHYRSTIEYSPTALDEAVTAYRRIESFLRRVVERTGAVDAGGELGEDF
FT                   VSSMDDDMGTPGALAAVHKRVREGNTALESGDDTGARAAASSVRAMTAVLGLDPLSERW
FT                   SASAGRESGTSRALKALVDRVLADRVAARKERDFARADALRDSLLAAGIAVEDTPDGPL
FT                   WTLKDS"
     gtgagcctcc acatctacga caccgcaagc agagaactgc gggagttccg cccgcagatc        60
     agcggaacgg cgtcgatcta cgtgtgcggg gcgacagtgc agggcgttcc ccacatcggg       120
     cacgtgcgca gcggcctcaa cttcgacgtg ctgcggcgct ggctcgcgcg cacccacgag       180
     cgggtcgtgc tggtgcggaa cgtcaccgac atcgacgaca agatcctggt caagtccgcc       240
     cagcacgacc ggacctggtg ggactgggcg ttcgagcacg agcgggcctt cgacgacgcc       300
     tacgaggcgc tcggctgcct gccgccgacc tacgcgccgc gcgccaccgg gcacgtgacg       360
     cagatggtcg agctgatgcg gcggctgatc gacgccgggc acgcgtacgc cgcgaacggc       420
     gacgtgtact tctcggtgtc ctcgttcccc gagtacggga agctgtccgg gcagcgggtg       480
     gacgaggtcc agcagggcga gtccgagctg accggcaagc gcgaccccag ggacttcacg       540
     ctgtggaagg ccgccaagcc cggcgagccc tcgtggccca cgccgtgggg cgacgggcgg       600
     cccggctggc acctggagtg ctcggccatg gcgaccgagt acctgggctc gacgttcgac       660
     gtgcacggcg gcggcatcga cctgatcttc ccgcaccacg agaacgagca ggcccagtcc       720
     agggcggtcg gcgacgggtt cgcgcggtac tggatgcaca acgcctgggt gacgctcagc       780
     ggcgagaaga tgtccaagtc gctggggaac accgtgtcga tcccggcgat gctggagcag       840
     gtccgcgcgc cggagctgcg gtactacctc gtcgggccgc actaccggtc gacgatcgag       900
     tactccccca ccgcgctgga cgaggcggtc accgcctacc ggcggatcga gtcgttcctg       960
     cggcgcgtgg tcgagcgcac cggggccgtg gacgcgggtg gcgagctggg cgaggacttc      1020
     gtgtcgtcga tggacgacga catgggcacc cccggcgcgc tcgccgcggt gcacaagcgg      1080
     gtgcgcgagg gcaacacggc gctggagtcc ggggacgaca ccggggctcg cgccgccgcg      1140
     tcgtcggtcc gggccatgac cgccgtcctc gggctcgacc cgctgtccga gcggtggtcc      1200
     gcctccgccg ggcgcgagag cgggacctcc cgcgcgctga aggcgctggt ggaccgggtg      1260
     ctcgccgacc gggtggcggc ccgcaaggag cgggacttcg cgcgggctga cgccctccgc      1320
     gacagcctgc tcgccgccgg aatcgccgtc gaggacaccc ccgacggtcc actgtggact      1380
     ttgaaggaca gctga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page