(data stored in ACNUC7421 zone)

EMBL: CP001630.PE356

CP001630.PE356       Location/Qualifiers
FT   CDS_pept        complement(392625..393236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0361"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2 (HAD-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 2 (HAD-like); HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: haloacid dehalogenase-like hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34330"
FT                   /db_xref="GOA:C6WGL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL4"
FT                   /inference="protein motif:TFAM:TIGR01493"
FT                   /protein_id="ACU34330.1"
FT                   /translation="MTIRAVLFDFSNTLFRLEHPSFALHGELMRALTAPFGLPDGFAVD
FT                   ADTWERRDLDPVAHREAHVEVLASAGAEDPDGFYESLLSPTRWQAYPDTAVALGTHLRT
FT                   AVVSNIGWDVRAVFARHGVLGRVDEFVLSYEEGVVKPDPKLFEVACERLGVEPGEALMI
FT                   GDSEEADGGARAVGCRFELVEPLPTQERPDALLDAISRHA"
     gtgaccatcc gcgccgtgct gttcgacttc tccaacacgc tgttccggtt ggagcacccc        60
     tcgttcgcgc tccacggcga gctgatgcgg gcgctgaccg cgccgttcgg cctgccggac       120
     gggttcgccg tggacgccga cacctgggag cggcgcgacc tcgacccggt ggcgcaccgc       180
     gaggcgcacg tggaggtgct ggcgagcgcg ggcgccgagg acccggacgg gttctacgag       240
     agcctgctct cccccacccg ctggcaggcc tacccggaca ccgcggtcgc gctgggcacg       300
     cacctgcgga cggccgtggt cagcaacatc ggctgggacg tgcgggcggt gttcgccagg       360
     cacggggtgc tcgggcgggt ggacgagttc gtgctgtcct acgaggaggg cgtggtcaag       420
     ccggacccga agctgttcga ggtggcctgc gagcggctgg gggtcgagcc gggcgaggcg       480
     ctgatgatcg gggacagcga ggaggcggac ggcggggcgc gcgcggtggg gtgccggttc       540
     gagctggtcg agccgctgcc cacgcaggag cggccggacg cgctgctgga cgcgatctcc       600
     cggcacgcct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page