(data stored in ACNUC7421 zone)

EMBL: CP001630.PE357

CP001630.PE357       Location/Qualifiers
FT   CDS_pept        complement(393471..393938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0362"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: eli:ELI_06290 bifunctional 2-C-methyl-D-
FT                   erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-
FT                   erythritol 2,4-cyclodiphosphate synthase protein; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34331"
FT                   /db_xref="GOA:C6WGL5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL5"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACU34331.1"
FT                   /translation="MRVGIGTDVHPVEPGRDCWMVGLLWEGADGCAGHSDGDVAAHALC
FT                   DALLSAAGLGDLGAVFGTSDPRWSGAHGVEFLAEARRLVEAEGFVVGNAAVQVIGNAPR
FT                   VGKRRAEAQKVLSEVLGGPVSVSGTTTDGLGLTGRGEGVAAVATALLLPKG"
     gtgagggtcg gcatcggcac ggacgtgcac cccgtggagc cgggtcgcga ctgctggatg        60
     gtcgggctgc tctgggaggg cgccgacggg tgcgccgggc actcggacgg ggacgtggcg       120
     gcgcacgcgc tgtgcgacgc gctgctgtcc gcggccgggc tgggcgacct gggcgcggtg       180
     ttcggcacca gcgacccgcg ctggtccggc gcgcacggcg tggagttcct ggcggaggcc       240
     cggcggctgg tcgaggccga ggggttcgtg gtcgggaacg cggcggtcca ggtgatcggg       300
     aacgcgccgc gggtgggcaa gcggcgggcc gaggcgcaga aggtgctgtc cgaggtgctg       360
     ggcggcccgg tctcggtgag cgggacgacc acggacgggc tcgggctgac cgggcgcggc       420
     gagggcgtcg cggcggtcgc gaccgcgctg ctgctgccca agggctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page