(data stored in ACNUC7421 zone)

EMBL: CP001630.PE358

CP001630.PE358       Location/Qualifiers
FT   CDS_pept        complement(393935..394627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0363"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   bcr:BCAH187_A0116 2-C-methyl-D-erythritol 4- phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34332"
FT                   /db_xref="GOA:C6WGL6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACU34332.1"
FT                   /translation="MGVVALVPAAGRGERLGFGMPKALVPVGGVPLLVRAIRGLFESGR
FT                   VRHVVVAAPPSDVDQVRTVTAPLAPAGGAVHVLAGGAERSDSVRLALEHALAEVPDVRV
FT                   VLVHDAARAFTPPTVVRDVVDAVLAGHPAVIPVLPVADTVKRVDTKGVVVDTPDRSLLR
FT                   VVQTPQGFDAATLRAAHESGLHATDDAGLVERLGVPVVTVTGHQDAMKVTTPFDLAVAE
FT                   ALLVGGTG"
     atgggtgttg tcgcgctcgt gcccgcggcg ggccggggtg agcggctggg cttcggcatg        60
     cccaaagcgc tcgtcccggt gggaggcgtg ccactcctgg tgcgcgcgat ccgagggctc       120
     ttcgagtccg gacgcgtgcg gcacgtcgtc gtcgcggcgc cgccgtccga tgtggaccag       180
     gtgagaactg tcaccgcccc gctggctccc gccggtgggg cggtgcacgt gctggccgga       240
     ggagccgagc ggtcggactc ggtccgcctg gcgctggagc acgcgctggc cgaggtgccg       300
     gacgtgcggg tggtcctggt gcatgacgcc gctcgcgcgt tcacccctcc caccgtggtc       360
     cgggacgtgg tggacgccgt gctggcgggc caccccgcgg tcatcccggt gttgcccgtg       420
     gcggacaccg tcaaacgggt cgacacgaaa ggggtcgtcg tcgacacccc cgaccgctcg       480
     ctgctgcgcg tcgtccagac gccgcagggc ttcgacgcgg ccacgctccg cgcggcgcac       540
     gagtcgggtc tgcacgcgac cgacgacgcg ggtctggtcg agcggctcgg tgtgcccgtc       600
     gtcacggtca cgggccacca ggacgcgatg aaggtcacca cgcccttcga cctcgcggtc       660
     gcggaggcgc tgctcgtggg aggaaccggg tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page