(data stored in ACNUC7421 zone)

EMBL: CP001630.PE359

CP001630.PE359       Location/Qualifiers
FT   CDS_pept        complement(394663..395151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0364"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   bcb:BCB4264_A4827 transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34333"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL7"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACU34333.1"
FT                   /translation="MVFKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLT
FT                   VRVPADNAEIVGVRDVVGQEGLDKVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREKDRGLSAGEKRMLAKARQILVSELALAEGTDEDKAEVLLDEVLATAS"
     atggttttca aggtcggaga gaccgtcgtc tacccgcacc acggtgccgc tctcatcgaa        60
     gcgatcgaga cccgcgtgat caagggcgag gagaagaagt acctcgtcct caaggtcgcc       120
     cagggcgacc tcaccgtccg cgtccccgca gacaacgccg agatcgtagg cgtgcgcgac       180
     gtggtcggcc aagagggtct ggacaaggtc ttcgaggtgt tgcgcgctcc ccacaccgag       240
     gagccgacca actggtcgcg gcggtacaag gccaacctgg agaagctcgc gtccggtgac       300
     gtgaacaagg tggccgaagt ggtgcgtgac ctctggcggc gcgagaagga ccgcgggctg       360
     tcggcgggcg agaagcggat gctggcgaag gcccggcaga tactggtcag cgaactggcg       420
     ctggccgagg gcaccgacga ggacaaggcc gaggtcctcc tcgacgaggt cctcgccacc       480
     gcgtcctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page