(data stored in ACNUC7421 zone)

EMBL: CP001630.PE36

CP001630.PE36        Location/Qualifiers
FT   CDS_pept        complement(40316..40678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34010.1"
FT                   /translation="MDEILGQVLRNAVWERLDLLTELASQADAPSLLSVARSELPRLTE
FT                   GWRALLAAHEPDDKGNCPECSGRWRQQKSPCSVWRAAYEHLVAGGLAPRPARHLRTAPV
FT                   TPPVTRSRRGVAVRAH"
     gtggacgaga tcctcggtca agttcttcgc aacgcggtct gggaacggtt ggacctgctc        60
     acggagctgg ccagccaggc cgacgcccct tccctcctgt cggtggcacg atccgagctc       120
     cctcggttga ccgagggatg gcgggcactg ctcgccgcgc acgaaccgga cgacaagggc       180
     aactgccccg agtgctccgg tcgttggcgg cagcagaaga gcccttgctc ggtgtggcgc       240
     gccgcgtacg agcacctggt cgcgggcgga ctggccccgc gcccggctcg gcacctccgc       300
     acggcgccgg tgacccctcc tgtcacccgg tcgcgccgag gagtagctgt ccgagcccat       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page