(data stored in ACNUC7421 zone)

EMBL: CP001630.PE360

CP001630.PE360       Location/Qualifiers
FT   CDS_pept        395536..396153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0C03894p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34334"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34334.1"
FT                   /translation="MAAVNGASGDVGVIAVRDAQLQFPVEEGRYATGGSAPLVVTIVNN
FT                   GTELDRLTSVTSTATGEAELSGDVELEPTTSIVAETAENAPGSSSARPTTTSAPSSASA
FT                   PSSGQPSSGQSSASSASSAPQSAASQSSQPSAAPSSGRPSSAPEATAEPGEVRIVLPDF
FT                   KQDVRPGQTIKVTFRFEKAGQLTLDVPIGATPEARVEQKSEH"
     gtggccgccg tcaacggcgc gtcgggtgac gtcggcgtca tcgcggtccg cgacgcccag        60
     ctccagttcc cggtggagga ggggcgctac gcgacgggcg gctccgcgcc gctggtcgtc       120
     accatcgtga acaacggcac cgagctcgac cggctcacct ccgtcaccag caccgcgacc       180
     ggcgaggccg agctgagcgg cgacgtcgag ctggagccga ccacgagcat cgtggccgag       240
     accgccgaga acgcgcccgg cagctcgtcg gcccgcccca cgaccacctc cgcgccgtcg       300
     agcgcgtcgg cgccgtcgtc cggtcagccg tcttcgggcc agtcgtcggc gtcgtccgcg       360
     tcgtcggccc cgcagtccgc cgcgtcgcag tcctcgcagc cctcggccgc gccgagcagc       420
     ggcaggccct cctccgcgcc cgaggccacg gccgagccgg gcgaggtgcg gatcgtgctg       480
     ccggacttca agcaggacgt gcgccccggt cagaccatca aggtgacgtt ccggttcgag       540
     aaggccgggc agctgaccct ggacgtgccg atcggcgcga cgcccgaggc ccgcgtggag       600
     cagaagtccg agcactga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page