(data stored in ACNUC7421 zone)

EMBL: CP001630.PE361

CP001630.PE361       Location/Qualifiers
FT   CDS_pept        396591..397979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0366"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34335"
FT                   /db_xref="GOA:C6WGL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL9"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACU34335.1"
FT                   /translation="MAKNVRAARPVYRCAECGHEVSKWVGRCPECQAWGTVEERGVAAP
FT                   ARFLAGATSGDARPIGQVDIESSRASATGVGELDRVLGGGLVPGAVVLLAGEPGVGKST
FT                   LLLEVAHQWASTVGRCLYVTGEESAGQVRLRADRTGNLHDEIYLAAESDISAVLGQVDA
FT                   VKPSMMIVDSVQTMSSLSIDGMPGGVSQVRAVTSGLISVAKERNLPIILVGHVTKDGSV
FT                   AGPRVLEHLVDVVLQFEGDRHSTLRLLRGIKNRFGAADEVGCFELRDDGIVGVPDPSGL
FT                   FLNRREQDVTGSAVTVVVEGKRPLLGEVQALVAPTSLPAPRRAVSGLDSARVAMVMAVL
FT                   EKRGRVPLGNKDVFAATVGGMRLVEPSVDLALALAVASAAVDQPLPHDLVVVGEVGLSG
FT                   ELRRVNGVGRRLSEAARLGYTRALVPPDAGPLPKETRALVANDLGEALRLLKITGKRGS
FT                   SKDE"
     gtggccaaga acgttcgggc ggcccggccc gtctaccggt gcgctgagtg cgggcacgag        60
     gtgtccaagt gggtcgggcg ctgcccggag tgccaggcgt ggggcacggt cgaggagcgc       120
     ggggtcgccg cgcctgcgcg gttcctcgcg ggcgccacga gcggcgacgc gcggcccatc       180
     ggccaggtcg acatcgagtc ctcgcgggcc tcggccaccg gggtcggcga gctggaccgg       240
     gtgctcggcg gcgggctcgt ccccggcgcg gtggtcctgc tggcgggcga acccggcgtc       300
     ggcaagtcca ccctcctgct ggaggtcgcc caccagtggg ccagcacggt cggtcggtgc       360
     ctctacgtga ccggtgagga gtcggcgggc caggtccggc tgcgcgccga ccgcaccggg       420
     aacctgcacg acgagatcta cctcgccgcc gagagcgaca tctcggccgt gctcgggcag       480
     gtggacgcgg tcaagccgag catgatgatc gtcgactcgg tgcagaccat gtcgtcgctg       540
     agcatcgacg ggatgccggg cggcgtgagc caggtgcggg cggtgacgtc cgggctgatc       600
     tcggtggcca aggagcggaa cctgccgatc atcctggtgg ggcacgtgac caaggacggc       660
     tcggtcgcgg gcccgagggt gctggagcac ctggtcgacg tggtgctcca gttcgagggc       720
     gaccggcact ccacgctgag gctgctgcgc ggcatcaaga accggttcgg cgcggcggac       780
     gaggtcggct gcttcgagct gcgcgacgac ggcatcgtcg gcgtgcccga cccgtccggc       840
     ctgttcctga accggcgcga gcaggacgtg accggctcgg cggtgacggt cgtggtggag       900
     ggcaagcgac cgctgctggg cgaggtgcag gcgctggtgg cgccgaccag cctgcccgcg       960
     ccccggcgcg cggtgagcgg gctggactcg gcgcgggtgg cgatggtgat ggcggtgctg      1020
     gagaagcgcg gccgggtccc gctgggcaac aaggacgtgt tcgccgcgac cgtgggcggg      1080
     atgcggctgg tggagccgtc ggtggacctg gcgctggcgc tggcggtcgc gtcggcggcc      1140
     gtggaccagc cgctgccgca cgacctggtg gtggtcggcg aggtggggct gtcgggtgag      1200
     ctgcgccggg tcaacggcgt gggccgcagg ctcagcgagg cggccaggct cggctacacc      1260
     agggccctgg tccccccgga cgcaggcccg ctgccgaagg agacccgagc gctggtggcc      1320
     aacgacctcg gcgaggcgct gcggctgctg aagatcacgg ggaagcgggg gagcagcaag      1380
     gacgagtag                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page