(data stored in ACNUC7421 zone)

EMBL: CP001630.PE362

CP001630.PE362       Location/Qualifiers
FT   CDS_pept        complement(398370..399224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0367"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B2467 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34336"
FT                   /db_xref="GOA:C6WGM0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM0"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34336.1"
FT                   /translation="MAQNNAELADFLKRARAQGDPERAGLPPDGRVRRVPGLRREEVAR
FT                   LAGVSTDYYTRLEQGRRIVPSPAVVDALGRALGLDDAGQAHLRDLIGVGGPVGRRRTTG
FT                   AQRLRPGVHQLFDSLDGVPALALGRRTDVLAANRLARALFTDFEAIPAPRRNYARWMFL
FT                   DPAARALFADWEAQARNAVESLRLEVGRDPGDRATLALLAELRELSPEFDRWWEQHRVH
FT                   QRTHGSKRLTHPLVGELTVEYETVALPGDPDTTLFLYTTAAGTASRQALDLLASWTLTA
FT                   LAR"
     gtggcccaga acaacgcgga gctggcggac ttcctgaagc gggcgcgggc gcagggcgac        60
     ccggagcggg ccgggctgcc gccggacggg cgggtgcggc gggtgccggg gttgcggcgc       120
     gaggaggtgg cgcggctggc cggggtgtcc acggactact acacgaggtt ggagcagggg       180
     cggcggatcg tgccgtcgcc cgcggtggtc gacgcgctcg ggcgggcgct cgggctcgac       240
     gacgccgggc aggcgcacct gcgggacctg atcggcgtgg gcggcccggt gggacggcgg       300
     cggaccaccg gcgcgcagcg gctgcggccg ggcgtgcacc agctgttcga ctcgctggac       360
     ggggtgcccg cgctggcgct ggggcggcgc acggacgtgc tggcggcgaa ccggctggcg       420
     cgggcgctgt tcaccgactt cgaggcgatc cccgcgcccc gccggaacta cgcccgctgg       480
     atgttcctgg acccggcggc gcgggcgctg ttcgcggact gggaggcgca ggcccgcaac       540
     gccgtggaga gcctgcggct ggaggtcggc cgcgaccccg gcgaccgggc cacgctggcg       600
     ctgctggcgg agctgcggga gctgagcccg gagttcgacc ggtggtggga gcagcaccgg       660
     gtgcaccagc gcacgcacgg ctccaagcgc ctgacgcacc cgctggtggg cgagctgacc       720
     gtggagtacg agacggtcgc gctgccgggc gacccggaca cgacgctgtt cctgtacacg       780
     acggcggccg ggaccgcgtc acggcaggcg ctggacctgc tggcgagctg gaccctcacc       840
     gcgctggcgc ggtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page