(data stored in ACNUC7421 zone)

EMBL: CP001630.PE363

CP001630.PE363       Location/Qualifiers
FT   CDS_pept        399383..400234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0368"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1910 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34337"
FT                   /db_xref="GOA:C6WGM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34337.1"
FT                   /translation="MTTPTTWFVTGASKGLGLELVRQLLAQGANVAATSRSADRLRAAL
FT                   ADADADTTRLLPLAVDLADEADVQRAVTAAAERFGRLDVVVNNAGYGYLAAVEETTAQA
FT                   VRDMLDVQVVGVWNVLRAALPVMREQRSGRVVNVSSVLGLVSLPGWALYCAGKFALEAM
FT                   TEALAGEVAGHGIEVTLVEPGYFRTSFLSPDSLALPETTTDHYPQIRRMVADHRALQGS
FT                   QLGDPARGAAEIIARASVAGAPLRQVLGSDSHAYATAKVDALRANLAAEADSAPRTDHP
FT                   AA"
     atgaccaccc ccaccacctg gttcgtcacc ggcgcgtcga agggcctcgg cctcgaactc        60
     gtccgccagc tcctcgcgca gggcgccaac gtcgccgcca cctcccgctc cgccgaccgc       120
     ctccgcgccg ccctcgccga cgccgacgcc gacaccaccc gcctgctgcc gctcgccgtc       180
     gacctcgccg acgaggccga cgtccagcgc gccgtcaccg ccgccgccga gcgcttcggc       240
     aggctggacg tggtggtcaa caacgcgggc tacggctacc tggccgccgt ggaggagacc       300
     accgcccagg ccgtccggga catgctggac gtgcaggtcg tcggcgtgtg gaacgtgctg       360
     cgcgccgcgc tcccggtcat gcgggagcag cgctccggcc gggtcgtcaa cgtctcctcg       420
     gtcctcggcc tggtctcgct gcccggctgg gccctgtact gcgcgggcaa gttcgcgctg       480
     gaggccatga ccgaggcgct ggccggcgag gtggccgggc acggcatcga ggtcaccctc       540
     gtggaacccg gctacttccg cacctcgttc ctcagcccgg actccctggc gctgcccgag       600
     accaccaccg accactaccc gcagatccgg cggatggtcg ccgaccaccg cgccctgcag       660
     ggctcccagc tcggcgaccc ggcgcgcggc gcggccgaga tcatcgcgcg ggcctcggtc       720
     gcgggcgccc cgctgcgcca ggtcctcggc tccgactcgc acgcctacgc caccgccaag       780
     gtcgacgccc tgcgcgcgaa cctcgccgcc gaggcggaca gcgcccccag gaccgaccac       840
     cccgcagcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page