(data stored in ACNUC7421 zone)

EMBL: CP001630.PE364

CP001630.PE364       Location/Qualifiers
FT   CDS_pept        complement(400639..403167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0370"
FT                   /product="trehalose-phosphatase"
FT                   /note="TIGRFAM: trehalose-phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: glycoside hydrolase
FT                   15-related; trehalose- phosphatase; KEGG: nmu:Nmul_A2309
FT                   glycoside hydrolase 15-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34338"
FT                   /db_xref="GOA:C6WGM2"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM2"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ACU34338.1"
FT                   /translation="MTAEALPAELRRAIVQLARTPRLLVACDYDGTLAPIVENPEDARP
FT                   LPEAVGALRSLAGLHETTTAVISGRALRDLATLSRLPAEVHLVGSHGSEFDVGFVHALD
FT                   ADARALHRRLEDELEKLVDGSEGVSLEIKPASIAVHVRRAPAEVGERVLEAVRTGPCTW
FT                   GGVQVTEGKAVVELAVVQTDKGHALDVLRHRVSATASVFVGDDVTDEKAFARLSGPDVG
FT                   IKVGDGETLAQYHITDSPDVSMVLALLLEERRNWLHGDQAVPIERLTMLANERSVALVT
FT                   PDARVNWLCHPEPDSAAVFADLLGGPSAGHFTIKPEHGSLPLGQRYVPGTMVVETRWSR
FT                   LLVTDYLDHDLPGHRTDLVRRISGSTNAVITFAPRPEFGQVPVRLLRERDGLRVAGTSE
FT                   PMVLRSPGVDWEITSDGVQETAVAVVRPREGAAILLELRCGTDDLSESTLGEPERRARA
FT                   GGFWSDWAATLKLPSVEPELVLRSALTLKGLVHHETGAIMAAATTSLPEELGGIRNWDY
FT                   RYCWLRDAALTAQALVSVGSLTEAEAFLGWVHGVLDTLPGPERLHPLYTLQGTMLGAEA
FT                   VIDTLPGYAGSRPVRVGNLANQQVQLDVFGPVVDLVAELASARGALTDEDWRMVQAMAE
FT                   AVARRWHEPDHGIWEERHAPRHHVYSKVMCWVTLDRAVRLAEQYGRALDPSWPVLRDTI
FT                   ATDVLKNGWSDVAQSFTTAYDGDDLDAASLHVGLAGLIDPADERFQATVTAIEAELRSG
FT                   STVYRYRRDDGLPGDEGGFHLCAAWMIESYLLTGRRTEAEELFAQMVDAAGPTGLLPEE
FT                   YDPIAERSLGNHPQAYSHLGLIRCAQLLAK"
     ttgacggccg aggccctccc cgccgaactt cgtcgagcca tcgtccagct cgccaggaca        60
     ccacgactgc tggtggcctg cgactacgac ggcaccctgg ctccgatcgt ggagaacccc       120
     gaagacgccc gaccgctgcc ggaggcggtg ggcgcgctgc gctcgctcgc cgggctgcac       180
     gagacgacga ccgccgtgat ctccgggcgc gcgctgcgcg acctggcgac gctgtccagg       240
     ctgcccgcgg aggtgcacct ggtcggctcg cacggctccg agttcgacgt cggcttcgtg       300
     cacgcgctgg acgcggacgc cagggcgttg caccgcaggc tggaggacga gctcgagaag       360
     ctcgtcgacg gcagcgaagg cgtttcactg gagatcaagc ccgccagcat cgccgtgcac       420
     gtgcggcgag cgcccgccga ggtcggcgag cgcgtgctgg aggcggtgcg caccggtccc       480
     tgcacgtggg gcggcgtgca ggtcaccgag ggcaaggccg tggtggagct cgccgtggtg       540
     cagaccgaca agggccacgc cctcgacgtc ctgcgccacc gcgtgtccgc cacggcgtcc       600
     gtgttcgtcg gcgacgacgt cacggacgag aaggcgttcg cccggttgtc cgggccggac       660
     gtcggcatca aggtcggcga cggcgagacg ctggcgcagt accacatcac cgactcgccc       720
     gacgtgtcga tggtgctggc gctgctgctg gaggagcgca ggaactggct gcacggcgac       780
     caggccgtgc cgatcgagcg gctgaccatg ctcgccaacg agcggtcggt cgcgctggtc       840
     accccggacg ccagggtgaa ctggctgtgc cacccggagc cggactcggc ggcggtgttc       900
     gccgacctgc tcggcggccc gtccgcgggc cacttcacga tcaagccgga gcacggctcg       960
     ctgcccctgg gccagcggta cgtgccgggc acgatggtcg tggagacccg gtggtcgcgg      1020
     ctgctggtca ccgactacct ggaccacgac ctgccgggcc accgcaccga cctggtgcgg      1080
     cggatcagcg ggtccacgaa cgcggtcatc accttcgcgc cccggcccga gttcgggcag      1140
     gtgccggtgc ggctgctgcg cgagcgcgac ggcctccggg tcgcgggcac ctcggagccg      1200
     atggtgctgc gctcgccggg cgtggactgg gagatcacca gcgacggcgt ccaggagacc      1260
     gcggtcgcgg tcgtgcggcc gagggagggc gcggcgatcc tgctggagct gcgctgcggc      1320
     acggacgacc tgtccgagag cacgctgggc gagcccgagc ggcgcgcccg cgcgggcggg      1380
     ttctggtcgg actgggcggc gacgctgaag ctgccgtcgg tcgagccgga gctggtgctg      1440
     cggtcggcgc tgaccctcaa gggcctggtg caccacgaga ccggggccat catggcggcg      1500
     gcgaccacgt cgctgcccga ggagctcggc ggcatccgga actgggacta ccgctactgc      1560
     tggctgcggg acgcggcgct gaccgcgcag gcgctggtgt cggtcggctc gctgaccgag      1620
     gccgaggcgt tcctgggctg ggtgcacggc gtgctggaca cgctgcccgg cccggagcgg      1680
     ctgcacccgc tgtacacgct gcagggcacc atgctgggcg ccgaggcggt catcgacacg      1740
     ctgcccggct acgcggggtc gcggccggtg cgcgtgggca acctggcgaa ccagcaggtg      1800
     cagctggacg tgttcgggcc cgtcgtggac ctggtcgccg agctggcgag cgcgcgcggc      1860
     gcgctcaccg acgaggactg gcggatggtc caggccatgg cggaggccgt ggcgcggcgg      1920
     tggcacgagc cggaccacgg catctgggag gagcggcacg ctcccaggca ccacgtgtac      1980
     tcgaaggtca tgtgctgggt cacgctggac cgcgcggtgc ggctggccga gcagtacggg      2040
     cgcgcgctcg acccgtcgtg gccggtgctg cgggacacga tcgccacgga cgtgctgaag      2100
     aacgggtgga gcgacgtcgc ccagtccttc acgaccgcgt acgacggcga cgacctggac      2160
     gcggcctcgc tgcacgtggg gctggccggg ctgatcgacc cggcggacga gcggttccag      2220
     gccacggtca ccgcgatcga ggcggagctg cggtccgggt ccacggtcta ccggtaccgg      2280
     cgcgacgacg gtcttcccgg cgacgagggc gggttccacc tgtgcgccgc gtggatgatc      2340
     gagtcgtacc tgctgaccgg tcggcggacg gaggccgagg agctgttcgc gcagatggtc      2400
     gacgccgccg ggcccaccgg gctgctgccg gaggagtacg acccgatcgc ggagcgctcg      2460
     ctgggcaacc acccgcaggc gtacagccac ctcgggctga tccggtgcgc gcagctgctg      2520
     gcgaagtga                                                              2529
//

If you have problems or comments...

PBIL Back to PBIL home page