(data stored in ACNUC7421 zone)

EMBL: CP001630.PE365

CP001630.PE365       Location/Qualifiers
FT   CDS_pept        complement(403246..404682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0371"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="PFAM: glycosyl transferase family 20; KEGG:
FT                   scl:sce0488 Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34339"
FT                   /db_xref="GOA:C6WGM3"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM3"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ACU34339.1"
FT                   /translation="MSSIGENGADFLVVANRLPVDLERLPDGTQRWKHSPGGLVSALEP
FT                   FLRVHSGAWVGWPGVADADVEAFEEDGLQLHPVSLSSAEVTDYYEGFSNGTLWPLYHDV
FT                   VERPAFHRRWWNTYVRVNQRFADVTAKVAAHGATVWVQDYQLQLVPAMLRELRPDLRIG
FT                   FFLHIPFPPVELFMQLPWRTEIIRGLLGADLVGFHRPGGAQNFLWLARRLVGLEPSRGA
FT                   VGVRTRPGVVQVGDRTVRVGAFPISIDSSALDALARSKEVQARARQIREDLGNPKKVLL
FT                   GVDRLDYTKGIDVRLRALNELLEDGRVAPEDVVMVQLATPSRERVEHYKQMRGDIERMV
FT                   GRLNGEFSRVGRPVLHYLHQSVDRKELTAFMLAADVMVVTPVRDGMNLVCKEYVASRHD
FT                   LGGALVLSEFAGAAAELTSAFLVNPHDLDGVKKALEDALALDPAEGRRRMRALRRQVLT
FT                   HDVDRWARSFLEALGAQTAV"
     gtgagcagca ttggcgagaa cggcgcggat ttcctggtcg tggccaaccg cctgccggtc        60
     gacctggagc ggctgcccga cggcacgcag cggtggaagc acagccccgg cgggctggtg       120
     agcgcgctgg agccgttcct gcgggtgcac agcggcgcgt gggtcggctg gcccggagtg       180
     gccgacgcgg acgtggaggc gttcgaggag gacggcctcc agctccaccc ggtgtcgctc       240
     agctccgccg aggtcaccga ctactacgag gggttctcca acggcacgct gtggccgctg       300
     taccacgacg tggtcgagcg gcccgcgttc caccggcgct ggtggaacac ctacgtgcgg       360
     gtgaaccaga ggttcgcgga cgtgacggcg aaggtcgccg cgcacggcgc gacggtgtgg       420
     gtgcaggact accagctgca gctggtgccc gcgatgctgc gggagctgcg gccggacctg       480
     cggatcggct tcttcctgca catcccgttc cccccggtcg agctgttcat gcagctgccg       540
     tggcgaaccg agatcatccg cggcctgctc ggcgcggacc tggtcgggtt ccaccggccg       600
     ggcggcgcgc agaacttcct gtggctggcc cgcaggctgg tcggcctgga gccgagccgg       660
     ggcgcggtcg gcgtgcgcac gcggcccggt gtcgtgcagg tgggcgaccg cacggtgcgg       720
     gtgggcgcgt tcccgatctc gatcgactcc tcggcgctgg acgcgctggc ccgctccaag       780
     gaggtccagg cgcgggccag gcagatccgg gaggacctgg gcaatccgaa gaaggtgctg       840
     ctcggcgtcg accggctcga ctacaccaag ggcatcgacg tccggctccg ggcgctcaac       900
     gagctgctgg aggacggcag ggtcgcgccc gaggacgtgg tgatggtcca gctggccacg       960
     cccagccggg agcgggtcga gcactacaag cagatgcgcg gcgacatcga gcgcatggtg      1020
     ggcaggctca acggcgagtt ctcccgcgtc ggcaggccgg tgctgcacta cctgcaccag      1080
     tcggtcgacc gcaaggagct gacggcgttc atgctcgccg ccgacgtcat ggtggtgacg      1140
     ccggtgcgcg acgggatgaa cctcgtctgc aaggagtacg tggcgagcag gcacgacctc      1200
     ggcggggcgc tcgtgctgag cgagttcgcg ggggccgcgg cggagctgac ctcggctttc      1260
     ctggtcaacc cgcacgacct cgacggggtg aagaaagcgc ttgaggacgc cctcgctctc      1320
     gatcccgccg agggtcgccg taggatgcgc gctctgcgcc gccaagtcct cacacacgac      1380
     gtcgaccgct gggctcgctc gttccttgaa gccttgggcg cgcaaacagc cgtctga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page