(data stored in ACNUC7421 zone)

EMBL: CP001630.PE366

CP001630.PE366       Location/Qualifiers
FT   CDS_pept        complement(404791..406185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0372"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   rpt:Rpal_1546 protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34340"
FT                   /db_xref="GOA:C6WGM4"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM4"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ACU34340.1"
FT                   /translation="MSTRRKRYREPATLPDLWRPVEGPSLPDAPVVHLVLDLALRVGEV
FT                   QLASGAGAADVAATVSAVAQAYGMPRVEVDVTFTAITVSCHRGTSAAPVTSLRVVRSRG
FT                   LDYTRLDTLEDLIRRIAENEVTAEEAYAELDRITTAPHPYPRWVATAAWAGMAASVALL
FT                   VGGGLLLALSAALVTALVDRVGRLLNRRSLPFFFQQAAGGVLATAFALALYATDLLPGV
FT                   RPSLLVATGIVVLLSGLSLVGTVQDAITGYNVTAAGRFVEIVMLTSGLIAGVALTLRAG
FT                   VQLGVLTTMADPLPALISTVPLQLATGAATSMFFALASYARPKALMVAACAGAVGTTSY
FT                   GLLAVTGLNTIVCAAAAATLVGFVGALVSRKLRTPPLVVAVAGMVPLLPGWTIYRGLYQ
FT                   LTADGDPAGLSTLVYAGGTALALASGVALGEFLGEPVRTGFGRLERRLAGPRLSGPLWP
FT                   TRRRSE"
     gtgtcgacca ggcgcaagcg gtaccgggag cccgcgacgc tgcccgacct gtggcgtccc        60
     gtcgagggtc cgtccctgcc ggacgcaccc gtcgtccacc tggtgctgga cctggccctg       120
     cgcgtgggcg aggtccagct ggccagcggg gcgggcgcgg ccgacgtggc ggcgacggtg       180
     agcgcggtgg cccaggccta cgggatgccg agggtcgagg tggacgtgac gttcaccgcg       240
     atcaccgtgt cctgccaccg gggcacctcg gccgccccgg tgacctcgct gcgcgtggtg       300
     cgctcgcgcg gcctggacta cacccggctg gacacgctgg aggacctgat ccggcggatc       360
     gccgagaacg aggtgaccgc cgaggaggcc tacgccgagc tggaccgcat caccaccgcg       420
     ccgcacccgt acccccgctg ggtggccacg gcggcgtggg cgggcatggc ggcctcggtg       480
     gcgctgctgg tgggcggcgg cctcctgctg gcgctgtcgg ccgccctggt gaccgcgctc       540
     gtcgaccggg tcggccgcct gctgaaccgg cgctcgctgc ccttcttctt ccagcaggcg       600
     gcgggcggcg tcctggcgac cgcgttcgcg ctcgccctct acgccaccga cctgctgccc       660
     ggcgtgcgcc cgtcgctgct ggtggccacc ggcatcgtgg tgctgctgtc cggcctgtcc       720
     ctggtcggca ccgtgcagga cgccataacg ggatacaacg tcacggcggc cggccggttc       780
     gtggagatcg tcatgctcac ctcgggcctg atcgcgggcg tcgcgctgac cctgcgcgcg       840
     ggcgtgcagc tcggcgtgct gaccacgatg gccgacccgc tgcccgcgct gatctccacc       900
     gtgccgctcc agctggccac cggggccgcc acgtccatgt tcttcgcgct ggccagctac       960
     gcccgcccca aggcgctgat ggtggccgcg tgcgcgggcg cggtgggcac cacctcgtac      1020
     gggctgctcg cggtcaccgg cctgaacacc atcgtctgcg ccgccgccgc ggccaccctg      1080
     gtcggcttcg tcggcgcgct ggtgtcccgc aagctgcgca ccccgccgct ggtggtggcg      1140
     gtcgcgggca tggtgccgct gctgcccggc tggacgatct accggggcct gtaccagctg      1200
     accgcggacg gcgacccggc cgggctgtcc acactggtct acgcgggcgg caccgcgctc      1260
     gcgctggcca gcggcgtggc gctcggcgag ttcctcggcg agccggtgcg caccggcttc      1320
     ggcaggctgg agcggcgcct ggcggggccc cggctgtccg gcccgctgtg gccaacgcga      1380
     cgtcgttcgg agtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page