(data stored in ACNUC7421 zone)

EMBL: CP001630.PE367

CP001630.PE367       Location/Qualifiers
FT   CDS_pept        407108..408085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0374"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: ajs:Ajs_2855
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34341"
FT                   /db_xref="GOA:C6WGM5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM5"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACU34341.1"
FT                   /translation="MAVLRIHFTDADLARTRVARDPDPLWETVLGLYRLANDDVPVFEP
FT                   WRNRARLAVVERGAQAQVRMVRQLVPREGYFPDFLTPAEGRHGVAAGLEAVRGTPSLRL
FT                   LGDIAYAARSRPLPAWAHRVARSDRDALDELVSALKGVHDVLVRPAWEDAQAAVAAERA
FT                   ALGRTILDAGVDAALETLRPTLRWNPPVLEADYPKPLDVRLGGRGALLVPSYFCWGNPV
FT                   ALVDPALPPVIVYPVRHPANWTPDRSRSLGALLGRTRAAVLAALTGTATTTELAARLRL
FT                   SPASASEHVGVLRDSGLVVSRREGRTVLHSLTPLAQSLLEGRRA"
     gtggccgtgt tgcgcatcca cttcacggac gccgacttag cccgcaccag ggtggcccgc        60
     gaccccgacc ccctctggga gaccgtgctc ggcctctacc gcctggcgaa cgacgacgtg       120
     ccggtgttcg agccgtggcg caaccgcgcc cggctcgcgg tggtggagcg cggggcgcag       180
     gcccaggtgc ggatggtccg ccagctggtg ccgcgcgagg gctacttccc ggacttcctc       240
     accccggccg aggggcggca cggcgtcgcg gcggggctgg aggcggtgcg cggcacgccg       300
     tcgctgcggc tgctcggcga catcgcctac gcggcccgca gccgcccgct tcccgcgtgg       360
     gcgcaccggg tggccaggag cgaccgggac gcccttgacg agctcgtgag cgcgctcaag       420
     ggcgtgcacg acgtgctcgt gcgcccggcg tgggaggacg cgcaggcggc cgtcgcggcg       480
     gagcgcgcgg cgctcgggcg gaccatcctg gacgccggcg tcgacgccgc gctggagacc       540
     ctgcgcccca ccctgcggtg gaacccgccg gtgctggagg ccgactaccc gaagccgctg       600
     gacgtccggc tcggcgggcg cggcgcgctg ctggtcccgt cctacttctg ctggggcaac       660
     ccggtggcgc tggtggaccc cgcgctgccc ccggtgatcg tctacccggt ccgccacccg       720
     gccaactgga cgcccgaccg gtcccgctcg ctcggcgcgc tgctcggccg cacgcgcgcc       780
     gccgtgctgg ccgcgctcac cgggacggcc accacgaccg agctggcggc caggctgcgg       840
     ctgtcaccgg cctcggcgag cgagcacgtg ggcgtgctgc gcgactccgg cctggtggtg       900
     agcaggcgcg agggccgcac cgtgctgcac tccctcaccc cgctcgccca gtccctcctg       960
     gagggccgcc gggcctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page