(data stored in ACNUC7421 zone)

EMBL: CP001630.PE368

CP001630.PE368       Location/Qualifiers
FT   CDS_pept        complement(408188..409822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0375"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34342"
FT                   /db_xref="GOA:C6WGM6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34342.1"
FT                   /translation="MGNPTDRSATTGAGWWTNARVSVKILLAVGVVALVALVTGAVSWV
FT                   RLDTLNEQVQGIKNESMVRQANLLRVQNATAAMYRGMYLFGTADSAEGKAEGEKLVKDA
FT                   ESELDAAGSAYTSTPSTSAGWRQQVELYGASWNTYRGLLNVVLFGDAAPAGVTVPTSVA
FT                   ELGKAFTDSENGMNSAIDALSALEQAEGQAAAEAADSTVASARLWTVGVLVVGLALALL
FT                   LALLTGRSIGRRLERVRDVLASMADGDLTGSAPVDSRDEVGEMAVAVNRATENVRGAVS
FT                   ALAGSAQALAVNSRQLSSSADRIAGSAQDTAGRTDELAETSEEVSRNVQTVAAGAEQMG
FT                   AAIQEISQSASDAADVAAQAVQAAAVTNATVAKLGESSVEIGNVVKVITSIAEQTNLLA
FT                   LNATIEAARAGEAGKGFAVVANEVKDLAQETARATEDISRRVEAIQADTGGAVTAIEEI
FT                   GQIIARINDYQLTIASAVEEQTATTQEMNRGINEAAVGTTRIAGSISTVAGATRTTSAT
FT                   VVETQGAAMELSRMSAELQEQVDRFRI"
     atgggcaacc ccacggaccg atccgccacc accggcgcgg ggtggtggac gaacgcgcgc        60
     gtgagcgtga agatcctgct cgccgtcggc gtcgtcgcac tggtcgcgct ggtgaccggc       120
     gcggtgtcgt gggtgcgcct ggacacgctg aacgagcagg tccagggcat caagaacgag       180
     agcatggtcc ggcaggcgaa cctgctgcgc gtgcagaacg cgacagccgc catgtaccgg       240
     ggcatgtacc tgttcggcac cgcggactcg gccgagggca aggccgaggg cgagaagctg       300
     gtcaaggacg ccgagtccga gctggacgcg gcgggctccg cctacacctc cacgccgtcg       360
     accagtgccg ggtggcgcca gcaggtcgag ctgtacggcg cctcctggaa cacctaccgg       420
     ggactgctga acgtcgtgct gttcggcgac gcggccccgg cgggcgtgac cgtgccgacg       480
     agcgtggccg agctgggcaa ggcgttcacc gactccgaga acggcatgaa ctccgcgatc       540
     gacgcgctgt cggcgctgga gcaggccgag ggccaggcgg cggccgaggc cgccgactcg       600
     accgtcgcgt ccgcccggct gtggacggtc ggggtgctgg tggtcgggct cgcgctggcg       660
     ctgctgctgg cgctgctgac cggtcgcagc atcgggcggc ggttggagcg ggtgcgcgac       720
     gtgctggcct cgatggccga cggcgacctg accgggtcgg cgccggtgga ctcgcgtgac       780
     gaggtcggcg agatggcggt ggcggtgaac cgggccaccg agaacgtgcg gggcgcggtg       840
     tccgcgctgg cgggcagcgc gcaggcgctc gcggtgaact cgcggcagct cagctcctcg       900
     gcggaccgga tcgccgggag cgcgcaggac accgccgggc ggaccgacga gctggccgag       960
     acctcggagg aggtctcgcg gaacgtgcag accgtcgccg ccggggccga gcagatgggc      1020
     gcggcgatcc aggagatctc gcagtccgcg agcgacgcgg cggacgtggc ggcgcaggcc      1080
     gtgcaggccg ccgcggtgac caacgcgacc gtggcgaagc tgggcgagtc gtcggtggag      1140
     atcggcaacg tggtcaaggt gatcacctcg atcgcggagc agaccaacct gctcgcgctg      1200
     aacgccacca tcgaggccgc gcgcgccggt gaggcgggca agggcttcgc ggtggtcgcc      1260
     aacgaggtca aggacctggc ccaggagacg gctcgggcca ccgaggacat ctcgcggcgg      1320
     gtggaggcga tccaggccga caccggcggc gcggtgaccg cgatcgagga gatcgggcag      1380
     atcatcgccc ggatcaacga ctaccagctg accatcgcct cggcggtgga ggagcagacc      1440
     gccaccacgc aggagatgaa ccgcggcatc aacgaggccg cggtcgggac cacccggatc      1500
     gccgggagca tctcgacggt ggccggggcg acccggacca cctcggcgac cgtggtggag      1560
     acgcagggcg cggccatgga gctgtcccgg atgtcggccg agctgcagga gcaggtggac      1620
     cggttccgga tctga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page