(data stored in ACNUC7421 zone)

EMBL: CP001630.PE369

CP001630.PE369       Location/Qualifiers
FT   CDS_pept        complement(409989..411551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0376"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with GAF sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; GAF domain
FT                   protein; SMART: chemotaxis sensory transducer; GAF domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34343"
FT                   /db_xref="GOA:C6WGM7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34343.1"
FT                   /translation="MPFTSNRVRAELARALAALAEAEQDTAAVTAVVKALDGVKSSRDA
FT                   AKAALDVVRQRFGWVYGSYWQVDGTGGALRFAVESGDAGEEFRAVTREASFAEGVGLSG
FT                   RAWRSRDLVFVGDLGTLRDCVRAPVAQKVGVKSGICFPLTENGRVVGTMDFFSLEELNP
FT                   SKQRLEVLRSIGLLVAQAMERVVDVERQAASALDIQAVNAVLRGLGSATSEEEATRQAL
FT                   DTVRSEFGWAYGSFWAVDPTGQELRYVTESGDAGEEFRKITREASFRQGVGLAGRAWKS
FT                   REMLFVPDLADMTDCVRAPAARRVGVKSGVCLPLVVHGAVVGTMDFFSLSEIELTESRA
FT                   DALRNTAFLVSQSLERIRETTRISSAGAELVTSIEEVERNVVQATGVAAEAATLTSGAN
FT                   QAVGRLAQSSNEVGDVVKVINSIAEQTNLLALNATIEAARAGDAGKGFAVVANEVKDLA
FT                   QGTARATEDVARLISAIQSDASSVVTSLAEIEHIVDRINETQTMIGGVLTEQAAVTRDI
FT                   VGA"
     gtgccgttca ccagcaaccg agtcagagcg gaactcgcgc gagcactggc ggcgttggcc        60
     gaggcggagc aggacaccgc cgcggtgacc gccgtggtca aggcgctgga cggggtcaag       120
     tcctcccgcg acgccgccaa ggccgcactg gacgtcgtca ggcagcggtt cggctgggtg       180
     tacggctcct actggcaggt ggacgggacg ggtggggcgc tgcggttcgc ggtcgagtcc       240
     ggcgacgcgg gcgaggagtt ccgcgcggtc acccgcgagg cctcgttcgc cgagggcgtc       300
     ggcctgtccg gacgggcctg gcgcagccgc gacctggtgt tcgtcgggga cctcggcacg       360
     ctgcgggact gcgtgcgcgc gcccgtcgcg cagaaggtcg gcgtgaagtc cggcatctgc       420
     ttcccgctga ccgagaacgg ccgggtcgtc ggcacgatgg acttcttctc cctggaggag       480
     ctgaacccgt ccaagcagcg cctggaggtg ctgcgcagca tcgggctgct ggtcgcccag       540
     gccatggagc gggtggtcga cgtcgagcgc caggccgcgt cggcgctgga catccaggcg       600
     gtgaacgcgg tgctgcgcgg gctgggctcg gccacctccg aggaggaggc gacccggcag       660
     gcgctggaca cggtgcgcag cgagttcggc tgggcgtacg gctcgttctg ggcggtggac       720
     ccgaccgggc aggagctgcg gtacgtcacc gagtccggcg acgcgggcga ggagttccgc       780
     aagatcaccc gcgaggcctc gttccggcag ggcgtggggc tcgcggggcg ggcctggaag       840
     tcgcgcgaga tgctgttcgt cccggacctg gccgacatga ccgactgcgt gcgggcgccc       900
     gcggcgcggc gggtgggcgt gaagtccggg gtgtgcctgc cgctggtcgt gcacggcgcg       960
     gtcgtgggca cgatggactt cttctccctg tcggagatcg agctgaccga gagccgggcg      1020
     gacgcgctgc gcaacaccgc gttcctggtg tcgcagtcgt tggagcggat cagggagacg      1080
     acccggatca gctcggcggg cgcggagctg gtcacctcca tcgaggaggt cgagcgcaac      1140
     gtcgtgcagg cgacgggggt cgcggccgag gccgccacgc tgaccagcgg cgcgaaccag      1200
     gcggtcggca ggctggcgca gtccagcaac gaggtcggcg acgtcgtgaa ggtcatcaac      1260
     agcatcgccg agcagaccaa cctgctcgcc ctgaacgcca ccatcgaggc cgcgcgcgcc      1320
     ggtgacgcgg gcaagggctt cgccgtcgtc gcgaacgagg tcaaggacct cgcgcagggc      1380
     accgcccgcg cgaccgagga cgtggcgcgg ctgatcagcg cgatccagtc cgacgcgagc      1440
     agcgtggtga cctcgctggc cgagatcgag cacatcgtcg accggatcaa cgagacccag      1500
     acgatgatcg gcggtgtgct gaccgagcag gccgccgtca cccgcgacat cgtcggggcc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page