(data stored in ACNUC7421 zone)

EMBL: CP001630.PE37

CP001630.PE37        Location/Qualifiers
FT   CDS_pept        41233..42615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0037"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34011"
FT                   /db_xref="GOA:C6WCJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34011.1"
FT                   /translation="MNTIGSSNSPVTPEVWDQQEMRDALAKREISTVYRLLRRHGVSQR
FT                   QIAALTGQSQSEVSEILKGRQVMAYDVLTRIANGLGVPRGYMGLAYDEATAVRVAATAE
FT                   APHSEEDESVKRRKFLAHAAAITVGAAVFGTDSGSWTGSPAQTPAPGRIGMTDVRQVEA
FT                   ATKALRTLDYQYGGGSCRDAVVAQLSWGQQMLGANATELVKEWLFVALADLHNLAGWTS
FT                   FDTGLYDSARNHFGQALSLAKQGRKEELVANILYRMGRVYLHQDAPDDALKVFQLGQLA
FT                   AQNSGSELAVGILCANEAWAYAKMGSDTQALKLLGRARDEFARANVAEAPAWARFFDAN
FT                   DLSAMVGTVHTELAQTVDVKYTRTAIPALSKAIGGYGEDMTRSKSFNFISLSINHLLQG
FT                   DLDHGSKVGRQALDLSESLKSIRTKDRMKPLLGEAQKRRNNQDARELAERVSKFTGTDS
FT                   AA"
     ttgaacacca tcggttcgtc gaactctcct gttacgcccg aggtctggga ccagcaggag        60
     atgcgcgacg ccctggccaa gcgggagatc agcacggtct accggctgct gcgcaggcac       120
     ggcgtgtcgc agcgccagat cgcggcgctc accggtcagt cgcagtccga agtgtcggag       180
     atcctcaagg gtcgtcaggt catggcctac gacgtcctga ccaggatcgc caacggcttg       240
     ggtgtcccca ggggatacat gggcctcgcc tacgacgagg ccacggcagt gcgggtggcc       300
     gccacggcgg aggcacccca ttctgaggag gacgagtcgg tgaagcgaag gaagttcctc       360
     gcgcacgccg ccgccatcac cgtcggtgcg gccgtgttcg gcacggactc cgggtcttgg       420
     acgggctctc ccgcgcagac cccggccccc ggccggatcg gcatgaccga cgtccgccag       480
     gtcgaggccg ccaccaaggc cctgcgcacg ctggactacc agtacggcgg cggctcctgc       540
     cgcgacgccg tcgtcgccca gctgtcctgg gggcagcaga tgctgggcgc gaacgcgacc       600
     gagctggtca aggagtggct gttcgtcgcg ctcgccgacc tgcacaacct cgcgggctgg       660
     acgtcgttcg acaccgggct gtacgactcg gcgcgcaacc acttcgggca ggcgctcagc       720
     ctggccaagc aggggcgcaa ggaggagctg gtcgcgaaca tcctgtaccg gatgggccgc       780
     gtctacctgc accaggacgc cccggacgac gcgctcaagg tgttccagct cggccagctg       840
     gccgcgcaga actccggctc cgagctcgcg gtcggcatcc tgtgcgcgaa cgaggcgtgg       900
     gcctacgcga agatgggctc cgacacgcag gcgctcaagc tgctcggcag ggcgcgcgac       960
     gagttcgcca gggccaacgt cgccgaggcg cccgcgtggg cgcggttctt cgacgcgaac      1020
     gacctgtccg ccatggtcgg cacggtgcac accgagctgg cccagacggt ggacgtcaag      1080
     tacacccgca cggccatccc ggcgctgtcc aaggcgatcg gcggctacgg cgaggacatg      1140
     acgcgcagca agtcgttcaa cttcatctcg ctgtcgatca accacctgct ccagggcgac      1200
     ctcgaccacg gctccaaggt cgggcgccag gcgctcgacc tgtccgagag cctgaagtcg      1260
     atccgcacca aggaccggat gaagccgctg ctcggcgagg cgcagaagcg ccgcaacaac      1320
     caggacgccc gtgagctcgc cgaacgcgtc tccaagttca ccggcaccga cagcgcggcc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page