(data stored in ACNUC7421 zone)

EMBL: CP001630.PE370

CP001630.PE370       Location/Qualifiers
FT   CDS_pept        complement(411724..413376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0377"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_6334 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34344"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM8"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34344.1"
FT                   /translation="MAVPRRTTAAVALAAAALAAAPHAVAHAAPPAERVEQVAAAAPAA
FT                   SRCGPMDVVFALDDTGSMGGALNNIKTSINAVVGDVVSASGGDYRLGLVTFKDSINVVT
FT                   GLAAGNAGTVTGYVTNVLAASGGGGEPEASDEALRTAVSLRPAAGIPQNADFTGPWRSN
FT                   ARKFVVLVTDARPGGFDDAFTAADQASATAVANSALAAGVKLSAVYVPTSPSMTPTIAP
FT                   IMQNYATTTSGVYVQAQADGSGTADAIRKALSDCRRTDVFMRDQTTDNGVEVNPNGSVW
FT                   ASPDIKVCPTTADCATTYQPPVGSTSWIHVRLNNPGPYGSGTGAGTLKLYWVNPSGSTV
FT                   WNEATGGDWTFIGQQAATVPAGTTVVKVPWTNVPGPGHFCLLARWVSANDPMTHVEGAN
FT                   TAQNAKNNNNIAWRNVDTVRVRPTVPGRTSFTLGNAVEKEIRTDLLFTSPGKPFVGAGK
FT                   VVVDLGRELFERWQASGGQARGIERVGESAVQVLDPKQAALIGIAVRPGERFTAGLEFH
FT                   GGEPGGEYLLHVVQRLGDEELGGVAYQVLVEKE"
     atggctgttc cccggagaac caccgcggcg gtggcgctgg ccgccgccgc gctggccgcg        60
     gccccgcacg ccgtggcgca cgcggcgccc ccggccgagc gggtggagca ggtggccgcc       120
     gccgcgcccg ccgcctcccg gtgcgggccg atggacgtgg tgttcgcgct cgacgacacc       180
     ggcagcatgg gcggggccct gaacaacatc aagaccagca tcaacgcggt cgtcggcgac       240
     gtggtgtccg cgtccggcgg ggactaccgg ctggggctgg tcacgttcaa ggactcgatc       300
     aacgtggtca ccggcctcgc cgcgggcaac gcggggaccg tgaccggcta cgtgacgaac       360
     gtgctggccg cgtccggcgg cgggggtgag cccgaggcat ccgacgaggc gctgcgcacc       420
     gccgtgtcgc tgcgcccggc ggcgggcatc ccgcagaacg ccgacttcac cggcccgtgg       480
     cgctcgaacg cgcgcaagtt cgtggtgctg gtgaccgacg cccgccccgg cggcttcgac       540
     gacgccttca ccgccgccga ccaggccagc gccaccgccg tggcgaacag cgcgctcgcg       600
     gcgggcgtca agctgtcggc ggtctacgtg cccacctcgc cgtcgatgac accgaccatc       660
     gcgccgatca tgcagaacta cgccaccacc acgagcggcg tctacgtgca ggcccaggcg       720
     gacggcagcg gcaccgccga cgcgatccgc aaggcgctgt ccgactgccg ccgcaccgac       780
     gtgttcatgc gggaccagac caccgacaac ggggtcgagg tcaacccgaa cggctcggtg       840
     tgggccagcc cggacatcaa ggtctgcccg accacggcgg actgcgccac gacctaccag       900
     ccgcccgtgg gctccacgag ctggatccac gtgcggctga acaaccccgg cccgtacggg       960
     tccggcacgg gcgcgggcac gctcaagctg tactgggtga acccgagcgg gtcgacggtg      1020
     tggaacgagg cgaccggcgg cgactggacg ttcatcggcc agcaggccgc gaccgtcccg      1080
     gcgggcacga ccgtggtgaa ggtgccgtgg acgaacgtgc cgggccccgg ccacttctgc      1140
     ctgctggcgc gctgggtgtc cgcgaacgac ccgatgaccc acgtcgaggg cgccaacacc      1200
     gcgcagaacg cgaagaacaa caacaacatc gcgtggcgga acgtggacac cgtgcgggtg      1260
     cgcccgaccg ttccgggccg cacgagcttc accctgggca acgcggtgga gaaggagatc      1320
     cgcaccgacc tgctgttcac cagccccggc aagccgttcg tcggcgcggg caaggtcgtg      1380
     gtggacctgg gccgggagct gttcgagcgg tggcaggcct ccggcgggca ggcgcgcggg      1440
     atcgagcggg tcggcgagag cgccgtgcag gtgctcgacc cgaagcaggc ggcgctgatc      1500
     gggatcgcgg tgcggcccgg cgagcggttc acggcgggcc tggagttcca cggcggcgag      1560
     ccgggcggcg agtacctgct gcacgtggtg cagcgcctgg gcgacgagga gctgggcggc      1620
     gtcgcgtacc aggtcctggt ggagaaggag tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page