(data stored in ACNUC7421 zone)

EMBL: CP001630.PE371

CP001630.PE371       Location/Qualifiers
FT   CDS_pept        complement(413875..415284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0378"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gbm:Gbem_2673 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34345"
FT                   /db_xref="GOA:C6WGM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34345.1"
FT                   /translation="MRELVTGRRMRLGTRLALGLGALALAVFGLVGALVVTSMEDYLAR
FT                   KLDAQMKSTQIAQEKDFKENGDVLGPVYGWYYAVYEVRDGVAAPLPTHKLPDDDRPMAK
FT                   VATLVTGSQPVFKTVHFEGEGTYRVRGCPAGNGTVLVSAAPMDDLTTTVQQLTMVLVAL
FT                   FALALVALVVVGRAVLRRGLQPLSEMARTAHDITSHDLTDSARLPVRSEGSYGGVEVAE
FT                   LRTAFNTMLEHIDSSLAARTAAEQRLRRFIADASHELRTPLTSIRGYADLFRYAAANAP
FT                   EEREAHLEKLRAEAARMSVLLEELLLLARLDSAEAELPVRPENGDLVELVGQAVDAFRV
FT                   ARPGHPVALAVAHPRVPMRFDAGRLRQVLDNLLTNAAVHTPKGTAVSVSVDVVGGDAVV
FT                   RVSDSGPGIPARDQERIFDRFYRVDHSRTRDRGGSGLGLAVARSLVEAHRGRLDLESRP
FT                   GSTTFTITLPR"
     atgcgcgagc tggtcaccgg gcgcaggatg cggctgggca cccggctcgc gctgggcctg        60
     ggcgcgctgg cgctggcggt gttcgggctg gtcggggcgc tggtggtgac ctccatggag       120
     gactacctgg cgcgcaagct cgacgcgcag atgaagtcca cccagatcgc gcaggagaag       180
     gacttcaagg agaacggcga cgtcctcggg ccggtgtacg gctggtacta cgcggtgtac       240
     gaggtgcggg acggggtggc cgcgccgctg ccgacgcaca agctgcccga cgacgaccgg       300
     ccgatggcga aggtggccac gctggtcacc gggagccagc cggtgttcaa gaccgtccac       360
     ttcgagggcg agggcaccta ccgggtgcgc ggctgccccg cgggcaacgg gaccgtgctg       420
     gtgagcgcgg cccccatgga cgacctgacc acgaccgtgc agcagctgac catggtgctg       480
     gtggcgctgt tcgcgctggc gctggtggcg ctggtggtgg tcgggcgggc ggtgctgcgg       540
     cgcgggttgc agccgctgag cgagatggcg cgcaccgcgc acgacatcac ctcgcacgac       600
     ctgaccgact cggcgcggct gccggtgcgc tcggagggct cgtacggcgg ggtggaggtg       660
     gccgagctgc ggacggcgtt caacacgatg ctggagcaca tcgacagctc gctggccgcg       720
     cggacggcgg ccgagcagcg gttgcgccgg ttcatcgcgg acgcctcgca cgagctgcgc       780
     acgccgctga cctcgatccg ggggtacgcg gacctgttcc ggtacgcggc ggccaacgcg       840
     ccggaggagc gcgaggcgca cctggagaag ctgcgggccg aggcggcgcg gatgagcgtg       900
     ctgctggagg agctgctgct gctggcgcgg ttggactcgg cggaggccga gctgccggtg       960
     cggccggaga acggcgacct ggtggagctg gtcgggcagg cggtggacgc gttccgggtg      1020
     gcgcggccgg ggcatccggt cgcgctcgcg gtggcgcacc cgagggtgcc gatgcggttc      1080
     gacgcggggc ggttgcggca ggtgctggac aacctgctga ccaacgcggc ggtgcacacg      1140
     cccaagggca cggcggtgtc ggtgtcggtg gacgtggtgg gcggcgacgc ggtggtgcgg      1200
     gtgagcgact cgggccccgg catcccggcg cgcgaccagg agcggatctt cgaccggttc      1260
     taccgggtgg accactcgcg cacccgcgac cggggcggca gcgggctggg gctggcggtg      1320
     gcgcggtcgc tggtggaggc gcaccggggg cggctcgacc tggagagccg tccgggctcg      1380
     acgacgttca cgatcacgct gccgcgctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page