(data stored in ACNUC7421 zone)

EMBL: CP001630.PE372

CP001630.PE372       Location/Qualifiers
FT   CDS_pept        complement(415284..415985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0379"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bat:BAS2056 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34346"
FT                   /db_xref="GOA:C6WGN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34346.1"
FT                   /translation="MENGSPVRLLVVDDEPHIADLVATVARYEGWQAVTAGSGEAAIRA
FT                   ALDFQPDIVVLDLMLPDVDGFTVLDRLRGEGAMVPVVFLTARDGTADRVAGLTRGGDDY
FT                   LVKPFSVEELMARLRAVLRRSTGPSWKRSVLKVADLVLDEDTREVRRGDRLVTLTPTEY
FT                   ELLRYLMRRSPTVLTKAQILDHVWEYDFGGRSNVVELVVSHLRRKLDVEGDEPLIHTVR
FT                   GVGYVLRRAPS"
     gtggagaacg gttcaccggt ccgactgctc gtcgtcgacg acgagccgca catcgccgac        60
     ctggtggcca cggtcgcccg ctacgagggg tggcaggcgg tgacggcggg cagcggcgag       120
     gccgcgatca gggccgccct ggacttccag ccggacatcg tggtgctgga cctgatgctg       180
     cccgacgtgg acgggttcac cgtgctggac cggctgcgcg gcgagggcgc gatggtgccg       240
     gtggtgttcc tgaccgcgcg cgacggcacc gccgaccggg tcgcgggcct gaccaggggc       300
     ggcgacgact acctggtgaa gccgttctcg gtggaggagc tgatggcgcg gctgcgcgcg       360
     gtgctgcggc gcagcaccgg gccgtcgtgg aagcgctcgg tgctgaaggt ggccgacctg       420
     gtgctggacg aggacacccg cgaggtgcgg cgcggcgacc ggctggtgac gctgacgccg       480
     accgagtacg agctgctgcg ctacctgatg cgccgctccc ccacggtgct gaccaaggcg       540
     cagatcctgg accacgtgtg ggagtacgac ttcggcgggc gctcgaacgt ggtggagctg       600
     gtggtgtcgc acctgcgccg caagctggac gtggagggcg acgagccgct gatccacacc       660
     gtgcgcgggg tgggctacgt gctgcgccgg gcgccgagct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page