(data stored in ACNUC7421 zone)

EMBL: CP001630.PE373

CP001630.PE373       Location/Qualifiers
FT   CDS_pept        416139..417482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0380"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: ank:AnaeK_0310
FT                   oxidoreductase FAD/NAD(P)- binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34347"
FT                   /db_xref="GOA:C6WGN1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN1"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACU34347.1"
FT                   /translation="MTTLQAQAPAVRPRAAARTGLHAVLGANAAVVAVLFAQAGFGSNA
FT                   LILLGRLTGLYAALVLAFQLLLVARLPWFDRRLGMDRLTAWHRVTGISVVWLLVAHVVF
FT                   ITTGYAQLASLPPLDELVHLATTVEGVLRAVVAVVLVLVVGGASARWARRRLAYETWHF
FT                   IHLYAYLAVVLAFSHQVAAGTTFTSSPLATAYWWALWGAALAAVLVGRVGLPLWRNLRH
FT                   RLRVAAVVPESDDVVSIHITGRDLDKLPARAGQFFLWRFLERGRWWQANPFSLSAAPDG
FT                   RSLRLTAKALGAGSASLRSLKPGTRVFAEGPYGAFTALHRTRPNALLIAGGVGVTPVRA
FT                   LLEEIGGHAVVVYRVSERRDAVLLDELRGLARAKGAVLHVVTGATADHAPDAQPLGARA
FT                   LGAAVPDVRERDVFVCGPSRMTDAVLASLRELGVPANQVHAERFTLAR"
     gtgacaaccc tccaggccca ggcgcccgcg gtgcgcccga gagcggcggc ccgcaccggc        60
     ctccacgccg tgctgggcgc gaacgccgcc gtggtcgcgg tcctgttcgc ccaggccgga       120
     ttcggctcga acgcgctgat cctgctcggc aggctcaccg gcctgtacgc ggcgctggtg       180
     ctggcgttcc agctgctcct ggtggccagg ctgccgtggt tcgaccggcg gctcggcatg       240
     gaccggctca ccgcctggca ccgcgtcacc ggcatctcgg tggtgtggct gctggtggcc       300
     cacgtggtgt tcatcaccac cggctacgcg cagctcgcct cgctgccgcc gctggacgag       360
     ctggtgcacc tggccaccac cgtcgagggc gtgctgcgcg ccgtggtcgc ggtggtgctg       420
     gtcctggtgg tcggcggggc gtccgcccgc tgggcgcggc gcaggctcgc ctacgagacc       480
     tggcacttca tccacctgta cgcgtacctg gccgtggtgc tggcgttctc gcaccaggtc       540
     gccgcgggca ccaccttcac ctcctcgccg ctggccaccg cctactggtg ggcgctgtgg       600
     ggcgcggcgc tggcggcggt cctggtcggc cgggtcggcc tgccgctgtg gcgcaacctg       660
     cggcaccggc tgcgcgtggc ggccgtcgtg ccggagtcgg acgacgtcgt gtcgatccac       720
     atcaccggcc gcgacctgga caagctgccc gcccgcgcgg gccagttctt cctgtggcgc       780
     ttcctggagc gcgggcgctg gtggcaggcc aacccgttct ccctgtccgc cgccccggac       840
     ggccgctcgc tgcggctgac cgcgaaggcg ctcggcgcgg gcagcgcgtc gctgcgctcg       900
     ctgaagccgg gcacgcgcgt gttcgccgag gggccgtacg gcgcgttcac cgcgctgcac       960
     cggacccggc cgaacgcgct gctgatcgcg ggcggggtcg gggtgacgcc ggtgcgggcg      1020
     ctgctggagg agatcggcgg gcacgccgtg gtggtgtacc gggtcagcga gcggcgcgac      1080
     gcggtgctgc tggacgagct gcgcgggctg gcgcgtgcca agggcgcggt gctgcacgtg      1140
     gtgaccggcg cgacggccga ccacgccccg gacgcgcagc cgctcggggc gcgggcgctg      1200
     ggcgcggcgg tgccggacgt gcgcgagcgc gacgtgttcg tgtgcgggcc gagccggatg      1260
     acggatgcgg tgctggcgtc cctgcgggag ctgggcgtgc ctgcgaacca ggtccacgcc      1320
     gagcgcttca ccctggcccg atga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page