(data stored in ACNUC7421 zone)

EMBL: CP001630.PE374

CP001630.PE374       Location/Qualifiers
FT   CDS_pept        417520..417927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0381"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: mlo:mll6621
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34348"
FT                   /db_xref="GOA:C6WGN2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN2"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU34348.1"
FT                   /translation="MKRAIPVLLLTIAGLVPLWRYEPRAETTTVAAAEVPADSGAGSGS
FT                   GSTAAGRVVAGEVQETRYGQVQVQLTYEGDRITAVTMLKQPGSAPTRQAVPVLVEETLE
FT                   AQSAEVDSVSGATTTSAAYVRSLQSAIDSAE"
     gtgaagaggg cgatcccggt cctgctgctg accatcgcgg gcctggtccc gctgtggcgc        60
     tacgagccgc gggcggagac gacgacggtg gcggctgccg aggtcccggc ggactccggg       120
     gccgggtccg ggtccggttc gaccgcggcc ggccgggtgg tggcgggcga ggtgcaggag       180
     acccggtacg gccaggtcca ggtgcagctc acctacgagg gcgaccggat caccgccgtg       240
     accatgctca agcagccggg cagcgcgccc acccggcagg cggtgccggt gctggtggag       300
     gagacgctgg aggcgcagag cgcggaggtc gactcggtct ccggcgcgac cacgaccagc       360
     gccgcgtacg tgaggtcgct gcagtcggcg atcgactcgg cggagtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page