(data stored in ACNUC7421 zone)

EMBL: CP001630.PE375

CP001630.PE375       Location/Qualifiers
FT   CDS_pept        417932..418645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0382"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: mlo:mll6620
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34349"
FT                   /db_xref="GOA:C6WGN3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN3"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACU34349.1"
FT                   /translation="MRHVEQVMGFPVSVNVPDGDGHGAAVADVFEWLHEVDARFSPFKP
FT                   GSEVSRLGRGEDVEPSPDLAHVLAVSEWYREATGGAFAVRRGGVLDPCAVVKGWAVERA
FT                   ADLLRSAGVPRFVLNAGGDVATEGGPWRVGVRHPDHPDRFCAVLEVDGLAVATSARYER
FT                   GDHIVDARTGEPVTSLLSLTVVARSLEVADATATAAFALGREGVAWAASRPGCEVHAVD
FT                   ADRRVHRTPGLPLAP"
     gtgcgccacg tcgagcaggt catgggcttc ccggtctcgg tcaacgtccc ggacggcgac        60
     gggcacggcg cggcggtcgc ggacgtgttc gagtggctgc acgaggtcga cgcccgcttc       120
     agcccgttca agccgggcag cgaggtgagc aggctgggcc ggggcgagga cgtcgagccc       180
     tcgcccgacc tggcgcacgt cctggcggtg tccgagtggt accgggaggc caccgggggc       240
     gccttcgcgg tccgcagggg cggggtgctg gacccgtgcg cggtggtgaa gggctgggcc       300
     gtcgagcggg cggcggacct gctgcggtcg gcgggcgtgc cccgcttcgt cctgaacgcg       360
     ggcggcgacg tcgcgacgga gggcggcccg tggcgggtgg gcgtccgcca cccggatcac       420
     ccggaccgct tctgcgcggt cctggaggtg gacggcctgg cggtggcgac gtccgcgcgc       480
     tacgagcgcg gcgaccacat cgtcgacgcc aggaccggcg agccggtgac ctccctgctg       540
     agcctgacgg tggtcgcccg ctcgctggag gtggccgacg cgaccgcgac ggcggccttc       600
     gccctgggcc gcgagggcgt ggcgtgggcg gcgtcccggc cgggctgcga ggtccacgcc       660
     gtggacgccg accgcagggt ccaccgcaca ccgggcctgc cgctcgcgcc ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page