(data stored in ACNUC7421 zone)

EMBL: CP001630.PE376

CP001630.PE376       Location/Qualifiers
FT   CDS_pept        complement(418924..419154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34350"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34350.1"
FT                   /translation="MLVLAEHGRHAHRATDDGDVVLGLLPEEIGRQERPPRSDSGRPGF
FT                   EIPGGNRALVRSERLPVRLGERVGRARRASV"
     atgctggtcc tcgccgagca cgggcgccac gcgcaccggg cgaccgacga cggggacgtc        60
     gtcctcggcc tgctgccgga ggagatcggc aggcaggagc ggcccccgcg ctccgactcc       120
     gggcgtcccg gcttcgagat ccccggcggg aaccgggcgc tcgtccgcag tgagcgcctg       180
     ccggttcggc tcggcgagcg ggtggggcgg gcgcggcggg cttcggtgtg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page