(data stored in ACNUC7421 zone)

EMBL: CP001630.PE377

CP001630.PE377       Location/Qualifiers
FT   CDS_pept        complement(419414..420451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0384"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   dol:Dole_0265 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34351"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN5"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACU34351.1"
FT                   /translation="MPREPMAVVDRGAACLLGGALGDALGAPVQYLGLPDIQRDHGPDG
FT                   VLEPPWPALVTDDTQLTLFSADGYLRAWVRGKRTGEWEPVDEVWNSYRRWLVTQQFAAP
FT                   DEGATGLLAQGRLYASRSPGLTCLRALAADVPPTPEAPINESSGCNGVTRTAPAGFAPH
FT                   PDIAYDLGCRFAALTHGGTGGWVSGGAFALLIHLLAVRGRPLREAVDQVIGRVLRDDPY
FT                   TANALNRAVVYAEEQRATGGPVRVDRLGSGWTGPEALAIAVHTVLVYPKRSQVVDALRT
FT                   AANHSGGSDATASLTGNILGALHGTAGLPREWLAGLELVDVLAALGADLGCSVSGLEFD
FT                   ESLYA"
     gtgccgcgcg agccgatggc ggtggtggac cgtggcgcgg cgtgcctgct gggcggcgcg        60
     ctcggcgacg cgctcggcgc gcccgtgcag tacctgggcc tgccggacat ccagcgggac       120
     cacgggccgg acggggtgct ggagccgccg tggcccgcgc tggtgaccga cgacacgcag       180
     ctgacgctgt tcagcgcgga cgggtacctg cgggcgtggg tgcgcgggaa gcgcaccggc       240
     gagtgggagc cggtcgacga ggtgtggaac agctaccgca ggtggctggt gacccagcag       300
     ttcgccgcgc ccgacgaggg cgccaccggg ctgctagcgc aggggcggct gtacgcgagc       360
     cggtcgccgg gcctgacgtg cctgcgcgcg ctggccgccg acgtcccgcc gacgccggag       420
     gcgccgatca acgagtcgtc gggctgcaac ggggtgaccc ggacggcccc ggcgggcttc       480
     gcgccgcacc cggacatcgc gtacgacctg gggtgccggt tcgcggcgct gacgcacggc       540
     ggcaccgggg ggtgggtgtc gggcggggcg ttcgcgctgc tgatccacct gctggcggtg       600
     cgcgggcggc cgttgcgcga ggcggtggac caggtgatcg ggcgggtgct gcgggacgac       660
     ccgtacacgg cgaacgcgct gaaccgcgcg gtggtgtacg cggaggagca gcgggcgacc       720
     ggcggaccgg tgcgggtgga ccggctgggg agcgggtgga ccgggccgga ggcgctggcg       780
     atcgcggtgc acacggtgct ggtgtacccg aagcggtcgc aggtggtgga cgcgctgcgg       840
     acggcggcga accactccgg cggcagcgac gccacggcct cgctgacggg gaacatcctg       900
     ggcgcgctgc acggcacggc gggactgccg cgcgagtggc tggcggggct ggagctggtg       960
     gacgtgctgg ccgcgctcgg ggcggacctg gggtgctcgg tgtcggggct ggagttcgac      1020
     gagtcgctgt acgcgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page