(data stored in ACNUC7421 zone)

EMBL: CP001630.PE378

CP001630.PE378       Location/Qualifiers
FT   CDS_pept        420623..423445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0385"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; NB-ARC
FT                   domain protein; transcriptional regulator domain protein;
FT                   KEGG: scl:sce8759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34352"
FT                   /db_xref="GOA:C6WGN6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34352.1"
FT                   /translation="MGDRSRCGLEFGVLGPLRVVADGGPIAIGRRGVRALLAVLVLEAN
FT                   RVVPIDELVDRLWGDEPPATARTIVHGYVSRLRKVLDAADPAGSARILTTPPGYQLAVD
FT                   PWRLDHHRARRLISSARGKPATSRAPLLRDALRLWRGPVLADVPNAPGSDLAELRLVAL
FT                   EERAAAELELGHHLEVVGELRQLVAEHPFRERLVAQAVLALYRSGRRADALDAYQRFHR
FT                   RLVDELGIDPGPDLRALHERVLRDDPALLPARAPETPGVAPRPGVVVPAQLPAAASGFV
FT                   GRDEELAWLDRLCDTRDRDATTTAVLDGPPGIGKSELAVAWGHRRAAQFPDGLLFAQLG
FT                   GHADDERARVGPDEVLARFLLALGVPADAVPRGTADRVGLYRSVLAGRRVLVVLDDARD
FT                   AEHVRLLLPPGSGSLALVTSRLRLGSLVVSAGARVLTLDVLAEDESARLVDEAVGKPLS
FT                   EQEPDAVRDLARLCGNLPLALRIAAARLVSSPEWAVASLVDALADDSTRLRALDLADAD
FT                   AGGGVGVARALALSYRELPDELAEVFRAAGLVPGRRVTAQAVAALCRTDAGTAARRLAE
FT                   LADAHLLLERGRGDYALHDLVRLYARELLADVPPERTAAALGRLLDHYLAACDRARRLL
FT                   RPATDGLDPGQSDHRAARPATSGQALLWFDKEWPNIVALARAGAERGLHRRVWQLVRLV
FT                   HTRCAVRAVDDGWSELAAIGLASARAEGDPRGEVLVLHAAHSVALRTGPAPGPLADARR
FT                   AHRIAEGLGEARYLVLALDQLASALLATGETGAAITRYREAVEAARRDGDVLGEAHVLN
FT                   NLAQAEQAAGRRETAARHQFQAAELFHRTGDQRGHALAVGNLAELYAELDLLVEAEESA
FT                   RQAVQLAVGGTMRYEEAFGRQVLGAVLARRGERSAARAELVESLRLFERLGSPRAASVR
FT                   IALDGLGGVF"
     atgggtgacc ggagcaggtg cggtctcgag ttcggcgtcc tcggtccgct cagggtggtc        60
     gcggacggcg ggcccatcgc gatcgggcgc aggggggtgc gggcgctgct ggcggtcctg       120
     gtcctggagg ccaaccgggt cgtgccgatc gacgagctcg tcgaccgcct gtggggcgac       180
     gagccgcccg cgacggccag gaccatcgtc cacggctacg tctcgcggct gcgcaaggtc       240
     ctcgacgcgg cggacccggc gggctccgcg cgcatcctca ccaccccgcc cggctaccag       300
     ctggccgtcg acccgtggcg cctcgaccac caccgcgccc gcaggctgat ctcctcggcg       360
     cgcggcaagc ccgccacgtc cagggccccg ctgctgcgcg acgcgctgcg gctgtggcgc       420
     ggcccggtgc tggccgacgt gcccaacgcc cccggcagcg acctggccga gctgcgcctg       480
     gtcgccttgg aggagcgggc cgccgccgag ctggaactgg gccaccacct ggaggtcgtc       540
     ggggagctgc gccagctggt cgccgagcac ccgttccgcg agcgcctggt cgcccaggcc       600
     gtcctcgccc tctaccgctc cggccgccgc gccgacgccc tcgacgccta ccagcgcttc       660
     caccgcaggc tcgtggacga gctgggcatc gaccccggcc cggacctgcg cgccttgcac       720
     gagcgggtgc tgcgcgacga cccggccctg ctgcccgcca gggcccccga gacccccggc       780
     gtcgcgccac gtcccggcgt ggtcgtgccc gcccagctgc ccgccgccgc cagcggcttc       840
     gtcggccgcg acgaggagct ggcctggctc gaccggctgt gcgacacccg cgaccgggac       900
     gccaccacca ccgccgtcct cgacgggccg cccggcatcg gcaagagcga gctggccgtc       960
     gcctggggcc accgcagggc cgcccagttc cccgacggcc tgctgttcgc ccagctcggc      1020
     gggcacgccg acgacgagcg cgcgcgggtc ggcccggacg aggtgctggc caggttcctg      1080
     ctcgcgctgg gcgtccccgc cgacgccgtg cccaggggga cggccgaccg ggtcggcctc      1140
     taccgctccg tgctggcagg ccgccgcgtc ctggtcgtgc tggacgacgc ccgcgacgcc      1200
     gagcacgtcc gcctgctcct gccgcccggc tccggctcgc tcgccctggt caccagcagg      1260
     ctgcgcctcg gctcgctggt ggtcagcgcg ggcgcccgcg tgctcaccct ggacgtcctc      1320
     gccgaggacg agtcggcccg gctggtcgac gaggccgtgg gcaagccgct gtccgagcag      1380
     gagcccgacg cggtccgcga cctggcccgg ctgtgcggca acctgccgct ggcgctgcgg      1440
     atcgccgccg ccaggctcgt ctccagtccg gagtgggcgg tcgcgtcgct ggtcgacgcg      1500
     ctcgccgacg acagcacccg cctgcgcgcc ctcgacctcg ccgacgcgga cgcgggcggc      1560
     ggcgtcggcg tggcccgcgc gctcgccctg tcctaccggg agctgcccga cgagctggcc      1620
     gaggtgttcc gcgccgccgg gctggtcccc ggccgcaggg tcaccgcgca ggccgtcgcc      1680
     gcgctgtgcc ggaccgacgc gggcacggcg gcccgccgcc tcgccgagct ggccgacgcg      1740
     cacctgctgc tggagcgcgg gcgcggcgac tacgccctgc acgacctggt ccgcctctac      1800
     gccagggagc tgctcgccga cgtcccgccc gagcgcaccg ccgccgccct cggcaggctc      1860
     ctggaccact acctcgccgc gtgcgaccgg gcccgcaggc tgctgcgccc ggccaccgac      1920
     ggcctcgacc ccggccagtc cgaccaccgc gccgcccgcc ccgccacgtc cggccaggcg      1980
     ctgctgtggt tcgacaagga gtggccgaac atcgtcgccc tggccagggc gggcgccgag      2040
     cgcggcctgc accgccgggt gtggcagctg gtccggctcg tgcacacccg ctgcgcggtc      2100
     cgcgcggtcg acgacggctg gtccgagctg gccgccatcg ggctcgcctc ggcccgcgcc      2160
     gagggcgacc cgcgcggcga ggtgctggtg ctgcacgccg cgcacagcgt ggcgctgcgc      2220
     accggcccgg cgcccggtcc gctcgcggac gcccggcggg cgcaccggat cgccgagggc      2280
     ctcggcgagg cccgctacct ggtgctggcg ctggaccagc tcgcctccgc gctgctggcg      2340
     accggcgaga ccggggcggc catcacccgc taccgcgagg ccgtcgaggc ggcccggcgc      2400
     gacggcgacg tgctcggcga ggcgcacgtg ctcaacaacc tcgcccaggc cgagcaggcc      2460
     gccgggcgca gggagaccgc ggcgcgccac cagttccagg ccgcggagct gttccaccgc      2520
     accggcgacc agcgcggcca cgccctcgcg gtcggcaacc tcgccgagct gtacgcggag      2580
     ctggacctgc tggtggaggc cgaggagagc gcgaggcagg ccgtgcagct cgcggtcggc      2640
     gggaccatgc ggtacgagga ggcgttcggc cgccaggtcc tcggcgcggt gctggcccgg      2700
     cgcggcgagc ggtcggcggc gcgggccgag ctggtggagt cgctgcggct gttcgagcgg      2760
     ctcggctcac cgagggcggc gtcggtccgg atcgcgctgg acggcctcgg cggggtgttt      2820
     tag                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page