(data stored in ACNUC7421 zone)

EMBL: CP001630.PE379

CP001630.PE379       Location/Qualifiers
FT   CDS_pept        complement(423636..424412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0386"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bcb:BCB4264_A2458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34353"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN7"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACU34353.1"
FT                   /translation="MQELDSYVAVGDSFTEGLDDPAPHGGYLGWADRLAAMISSRQRGF
FT                   RYANLAIRGRLLQAIVEEQVPVAVALKPSLVTFCAGGNDLLMPGADPDAVAEVYEIAVA
FT                   ELRATGAEVVIFTGFDPRHAPVLRSLRGKVAIYNSHLWSVAERYNCKVVDLWSMTVLHD
FT                   IRAWGPDRLHLAPEGHQRVALRVAELLGHEQEEQWRTPWPVVAEDDWMTQRRQDLKWAR
FT                   EHVVPFITRHLRGASLGDGVVPKRPELLPISSGENN"
     gtgcaggagt tggacagcta cgtcgcggtg ggggacagct tcaccgaggg cctggacgat        60
     ccagcacccc acggcgggta tctcgggtgg gccgaccggt tggcggccat gatctcctcg       120
     cgccagcggg ggttcaggta cgccaacctg gcgatccggg gcaggttgct ccaggcgatc       180
     gtggaggagc aggtcccggt cgcggtggcg ctcaagccga gcctggtgac gttctgcgcg       240
     ggcgggaacg acctgctcat gccaggggcg gacccggacg cggtggccga ggtgtacgag       300
     atcgcggtgg ccgaactgcg ggccacgggc gcggaggtcg tgatcttcac gggcttcgac       360
     ccgaggcacg cgccggtgct gcgctcgctg cggggcaagg tggcgatcta caactcgcac       420
     ctgtggtcgg tggccgagcg ctacaactgc aaggtcgtgg acctgtggtc gatgacggtg       480
     ctgcacgaca tcagggcgtg gggtccggac cggctgcacc tggcgcccga ggggcaccag       540
     cgggtggcgc tgcgggtggc cgagctgctc ggccacgagc aggaggagca gtggcgcacg       600
     ccgtggccgg tggtcgccga ggacgactgg atgacccagc gcaggcagga cctgaagtgg       660
     gcacgggagc acgtggtccc gttcatcacc aggcacctgc ggggcgcgtc gctcggtgac       720
     ggcgtcgtgc cgaagcggcc ggagctgctg ccgatcagca gcggcgagaa caactag          777
//

If you have problems or comments...

PBIL Back to PBIL home page