(data stored in ACNUC7421 zone)

EMBL: CP001630.PE38

CP001630.PE38        Location/Qualifiers
FT   CDS_pept        42689..43585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0038"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcz:BCZK4351 homoserine kinase type II (protein kinase
FT                   fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34012"
FT                   /db_xref="GOA:C6WCJ1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ1"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU34012.1"
FT                   /translation="MAGGGRFTPAVLADVLERLCAGLGLDHRGARLLKFTANAVYELPA
FT                   EQVVVRITGSMALRHRAPKVVAVARWLARHDVPAVRLVEDVPQPLVVGEHVATLWRTAP
FT                   SGGPPVDGRDLGRLLRLVHSLPEPDFAVPKWSPLEDVRRRIADAEELAADDLEFLEERC
FT                   AALAERLRSLETALPVGLVHGDAHLRNLIPSPDGPLICDFDSTGLGPREWDLSMVPVGA
FT                   ARLGHPWRWHEQLAAEYGFDVTGWPGYALLRDVRELKLTTSVLPILRSHPEVAPELRRR
FT                   LRSLREGDSGTRWEPYR"
     gtggcgggtg gtggccggtt cacccccgcc gtgctcgcgg acgtcctgga gcggctgtgc        60
     gcgggcctcg gtctcgacca ccggggcgcg cggctgctga agttcaccgc caacgcggtg       120
     tacgagctgc ccgccgagca ggtcgtggtg cggataacgg ggtcgatggc gctgcgccac       180
     cgggcgccca aggtggtcgc ggtcgcccgc tggctggccc ggcacgacgt gcccgccgtg       240
     cggctggtgg aggacgtgcc ccagccgctc gtcgtggggg agcacgtggc caccctgtgg       300
     cgcaccgcgc cgagcggcgg cccgcccgtc gacggccgcg acctcggcag gctgctccgg       360
     ttggtgcact cgctgccgga gccggacttc gcggtgccga agtggtctcc gctggaggac       420
     gtgcggcggc ggatcgccga cgccgaggag ctggcggcgg acgacctgga gttcctggag       480
     gagcgctgcg cggcgctcgc cgagcggctc cgctcgctgg agacggcgct cccggtcggc       540
     ctcgtgcacg gggacgcgca cctgcgcaac ctcatcccga gcccggacgg gcccctgatc       600
     tgcgacttcg actcgaccgg gctggggccg agggagtggg acctgtccat ggtcccggtc       660
     ggcgcggccc ggctcggcca cccgtggcgg tggcacgagc agctcgccgc cgagtacggc       720
     ttcgacgtga ccgggtggcc ggggtacgcc ctgctcaggg acgtgcgtga gctgaagctc       780
     accaccagcg tcctgccgat cctgcgcagc caccccgagg tcgcgcctga gctgcggcga       840
     cgacttcgat cactgcgcga gggcgattca gggacccgct gggagcccta ccgctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page