(data stored in ACNUC7421 zone)

EMBL: CP001630.PE381

CP001630.PE381       Location/Qualifiers
FT   CDS_pept        425108..425854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34355"
FT                   /db_xref="GOA:C6WGN9"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34355.1"
FT                   /translation="MHPGSMTDTRQESLAELLGGRSGALDASLPPAVFALGWLLGERSI
FT                   GAGALAAVLCGVVIGAYRLARGGKPRAVVVSLTLVVLAAYVALRTGRAEDFFLLRILLN
FT                   VGSALVWAASIVLRWPLLGVVVGLVTGQKLKWRKDPDLMRAYRYASWPWVGQYLLRVAV
FT                   FGGFWLAGQVVALGVAQVALSWPLQVVCVVVSWWVIRRSLPADHPGLRHPRVPGEPAEP
FT                   AQAAGPAVENPAPATGSAVEKPERVD"
     atgcaccctg ggagcatgac cgacactcgt caggagtcgc tggccgaact gctcggcggg        60
     cgcagcgggg cactcgacgc gtcactgccg cccgcggtgt tcgcgctcgg ctggctgctc       120
     ggcgagcgct ccatcggcgc gggcgcgctc gcggcggtgc tctgcggcgt ggtgatcggc       180
     gcctaccggc tggcgcgggg cggcaagccc agggcggtcg tggtgagcct gaccctggtg       240
     gtgctcgcgg cgtacgtggc gctgcggacc ggccgggccg aggacttctt cctgctgcgc       300
     atcctgctca acgtcggcag cgccctcgtg tgggcggcga gcatcgtgct gcgctggccg       360
     ctgctgggcg tggtggtcgg gctggtcacc gggcagaagc tcaagtggcg caaggacccc       420
     gacctgatgc gcgcctaccg gtacgcgagc tggccgtggg tggggcagta cctgctgcgg       480
     gtggcggtgt tcggcgggtt ctggctggcg gggcaggtgg tggcgctggg ggtcgcgcag       540
     gtcgcgctga gctggccgct gcaggtggtg tgcgtcgtgg tgagctggtg ggtgatccgc       600
     aggtcgctgc ccgccgacca ccccggcctg cggcacccgc gcgtgccggg ggagcctgcc       660
     gagcccgcgc aggcagccgg tcccgccgtc gagaaccccg cgcccgcaac gggttccgcc       720
     gtcgagaagc ccgagcgggt cgactag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page