(data stored in ACNUC7421 zone)

EMBL: CP001630.PE382

CP001630.PE382       Location/Qualifiers
FT   CDS_pept        complement(425911..426903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0389"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sme:SM_b21003 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34356"
FT                   /db_xref="GOA:C6WGP0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34356.1"
FT                   /translation="MELGIYSFGDLAPRSGGEPADVARRLADLVDQVRTADGAGLDVVA
FT                   IGEHHRREFTVSAPEIVLAALAGVTSSIRLASGVTVLSTQDPVRVFQQFATLDQLSGGR
FT                   AEVIVGRGAFTESFPLFGHDLRDYDELFDTKVKALLELTRSRELPVVNGVDVVPRPLQP
FT                   ELPVWIGVGGTPQSAIRAGVLGTPMFLAFFTGPETSRGTAELYRRAGEQAGHDPASLRL
FT                   ASGGHMFVGRTSQGAKDDFYPYYSDYFSLHPRMRDGMPRGVYDEWLRAGLLVGSPQEVV
FT                   DKILRHREVLGVDRYVGQFDVGGMPVAMTNRSLELFLTEVVPAVRAETA"
     atggaactcg gcatctactc gttcggcgac ctcgcccccc gctcgggcgg ggagcccgcc        60
     gacgtcgcgc gacggctcgc cgacctggtc gaccaggtca ggaccgccga cggggccggg       120
     ctggacgtcg tcgcgatcgg cgagcaccac cggcgcgagt tcaccgtctc cgcgccggag       180
     atcgtgctcg ccgcgctggc cggggtcacc tcgtcgatcc ggctcgcctc cggcgtgacc       240
     gtgctgtcca cccaggaccc ggtccgggtg ttccagcagt tcgcgacgct ggaccagctg       300
     tccggcgggc gggcggaggt catcgtgggg cgcggggcgt tcaccgagtc gttcccgctg       360
     ttcgggcacg acctgcgcga ctacgacgag ctgttcgaca ccaaggtgaa ggcgctgctg       420
     gagctgaccc gctcgcggga gctgccggtg gtcaacggcg tcgacgtcgt gccgaggccg       480
     ctgcagcccg agctgccggt gtggatcggg gtgggcggca cgccgcagtc ggcgatccgg       540
     gccggggtgc tgggcacgcc gatgttcctg gcgttcttca ccggcccgga gacctcgcgc       600
     ggcacggccg agctgtaccg gcgggcgggc gagcaggccg ggcacgaccc ggcgtcgctc       660
     cggctcgcca gcggcgggca catgttcgtc ggccggacct cgcagggcgc gaaggacgac       720
     ttctacccgt actactcgga ctacttctcg ctgcacccgc gcatgaggga cgggatgccc       780
     aggggcgtct acgacgagtg gctgcgcgcc gggctgctgg tgggcagccc gcaggaggtg       840
     gtggacaaga tcctgcggca ccgggaggtg ctcggggtgg accggtacgt cggccagttc       900
     gacgtgggcg ggatgccggt ggcgatgacc aaccgcagcc tggagctgtt cctcaccgag       960
     gtggtcccgg cggtgcgcgc ggaaaccgcc tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page