(data stored in ACNUC7421 zone)

EMBL: CP001630.PE383

CP001630.PE383       Location/Qualifiers
FT   CDS_pept        427020..427901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0390"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: acr:Acry_2830 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34357"
FT                   /db_xref="GOA:C6WGP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34357.1"
FT                   /translation="MELRHLKHFVALAEESSFTRAAERELIVQSGLSSSIRSLERDVGS
FT                   ELFVRGSRPVRLTAAGRALLPGARRTLQESERAKQLVRDVRGLVAGPFTIGTLPLHNRD
FT                   VSCRFVNWLASFATAHPGLDISVRQPGRDRALALVAEGGLDCAVVTGAPARLPGLRATR
FT                   LSTQPVVALLASGHPLAGRDGLALADLAGERFVDTYPGHESRDLVDLAFAERGLTRRIS
FT                   CEVVDLPMVFNLTRAGLGVALVPARTDLPAEGVVAVPLREEGLVHTVDLVLPKDPATSP
FT                   AAAAFAAHVAAG"
     gtggaactgc ggcacctgaa gcacttcgtc gcgctggccg aggagtccag cttcacgagg        60
     gcggccgagc gcgagctgat cgtgcagtcc ggcctgtcct cgtcgatccg gtccctggag       120
     cgcgacgtcg gctccgagct gttcgtcagg ggctcccgcc cggtccgcct gaccgcggcg       180
     ggccgggcgc tgctccccgg cgcgcggcgc accctgcagg agtccgagcg ggccaagcag       240
     ctcgtccggg acgtgcgggg cctggtcgcg ggcccgttca ccatcggcac gctcccgctg       300
     cacaaccggg acgtgtcgtg ccgcttcgtg aactggctgg cgtcgttcgc gaccgcccac       360
     cccggcctgg acatctcggt gcggcagccg ggccgcgacc gcgcgctggc gctggtcgcc       420
     gagggcggcc tggactgcgc ggtcgtcacc ggcgcgcccg cccgcctgcc cggactgcgg       480
     gccacccgcc tgtccaccca gccggtggtc gcgctgctcg cgtcgggcca cccgctggcg       540
     ggccgggacg ggctggcgct ggcggacctg gcgggggagc ggttcgtgga cacctacccc       600
     ggccacgaga gccgggacct ggtggacctg gcgttcgccg agcgcgggct gacccggcgg       660
     atcagctgcg aggtggtcga cctgccgatg gtgttcaacc tgaccagggc gggactgggc       720
     gtggcgctgg tgcccgcgcg gaccgacctg cccgccgagg gcgtcgtggc ggtgccgctg       780
     cgcgaggagg gcctggtgca caccgtggac ctggtgctgc cgaaggaccc ggcgacgtca       840
     ccggcggcgg cggcgttcgc ggcgcacgtg gcggccgggt ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page