(data stored in ACNUC7421 zone)

EMBL: CP001630.PE384

CP001630.PE384       Location/Qualifiers
FT   CDS_pept        complement(428065..429006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0391"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   slo:Shew_1116 ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34358"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP2"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ACU34358.1"
FT                   /translation="MSFVVGVDGGGTSTRALVVGADGTRLGAGVAGGSNPNSVGSGTAA
FT                   ANLRLALEGALSGVDAGAVVAGVLGMAGSSKLTDPGVDALFRAAWAGAGLRCPMRVVTD
FT                   CEAAFAAGTPAPDGTVLVAGTGSIAARVRGRRVVGTVGGHGWLLGDEGSAFWLGREAVR
FT                   AALRALEAGELDGLARAVLERAGVDEGPGAWARLITAANAGPPVALAGYAPLVTAAAGA
FT                   PGEVVAARIVDGCARVLADLAAAARTAEEVAPVVLVGSLVGAPVLGERLRAELAARVDG
FT                   EVVVVREAAVGAAWLAALESGVEDGWRERALG"
     atgagcttcg tggtcggcgt tgacgggggc ggcacgtcca ccagggcgct ggtcgtcggc        60
     gccgacggga cccggctggg ggccggggtc gcgggcgggt cgaacccgaa ctcggtgggg       120
     tccgggacgg ccgccgcgaa cctgcggctg gcgctggagg gcgcgctgtc cggggtggac       180
     gcgggcgcgg tcgtggccgg ggtgctcggg atggccgggt cgagcaagct gaccgaccca       240
     ggggtggacg cgctgttccg ggcggcctgg gcgggtgcgg ggctgcgctg cccgatgcgg       300
     gtggtgaccg actgcgaggc cgcgttcgcc gcggggacgc ccgcgccgga cggcacggtc       360
     ctggtcgcgg gcaccgggtc gatcgcggcg cgggtgcgcg ggcggcgggt ggtcggcacg       420
     gtcggcgggc acgggtggct gctcggggac gaggggtcgg cgttctggct gggccgtgag       480
     gcggtgcggg cggcgctgcg ggcgctggag gcgggcgagc tggacgggct ggcgcgcgcg       540
     gtgctggagc gggccggggt cgacgagggg ccgggcgcgt gggcgcggct gatcacggcg       600
     gcgaacgcgg ggccaccggt ggcgctggcc gggtacgcgc cgctggtgac ggcggcggcc       660
     ggggctcccg gcgaggtcgt ggcggcgcgg atcgtggacg ggtgcgcgcg ggtgctggcc       720
     gacctggcgg cggcggcgcg cacggcggag gaggtggcgc cggtggtgct ggtgggcagc       780
     ctggtgggcg cgccggtgct cggggagcgg ctgcgggcgg agctggcggc gcgggtggac       840
     ggcgaggtcg tggtggtgcg ggaggccgcg gtgggcgcgg cgtggctggc cgcgctggag       900
     agcggggtcg aggacgggtg gcgggagcgg gcgctggggt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page