(data stored in ACNUC7421 zone)

EMBL: CP001630.PE385

CP001630.PE385       Location/Qualifiers
FT   CDS_pept        complement(429003..432230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0392"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: glo:Glov_1721 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34359"
FT                   /db_xref="GOA:C6WGP3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACU34359.1"
FT                   /translation="MRLHRRAATAAALAAALAAPLAPLGHAAPDHPRPHRVTAFVELVG
FT                   VPAVDAAATARSDPREAARAARARTGNNADAVLDAVRSVDRGAARVGVTVNAVPGVVLT
FT                   AEPAVLRWVAGMPQVRSVRQAVPKRVDNAGAVRLTGAAAVWRAVGPSLPGHGGAVAGDG
FT                   LREGLRGEGLRIGVVDTGVDYTHADFGGSGGYDDVDRAGPWEPNAKVVGGYDFAGDDYD
FT                   ANDPERGTPAPDPNPVDCQGHGTHVAGTAAGYGVSADGSTFTGAHSGLSDDDLAAMRIG
FT                   PGAAPAAQVYALKVFGCEGSTNVVSQALDWALDPDGDGDPSDHLDVVNLSLGSDFGAVD
FT                   DPDSAFVRKLVRHGVVVVASAGNAGDLYDAGGSPGSTPEAVTVANTRDASVLLDGVGLP
FT                   GGSAEAGGSDEPGGSDEAGGSDGAGGGEEVLPGQYGKEFTGYADLDVELPVAPVADAGN
FT                   ADGCAPIDQDLSGRLVWLEWDDSDSTRECGSAVRADHARDAGAAGAVLSSGRTAFGAGI
FT                   AGNADVPMFQLTGPATDRVRPLLADGSLRLRLAGSLRDAAPTVVETLADTVTPSSARGS
FT                   RLAGGAKPDLAAPGDTIVSALVGSGSGGVSKGGTSMAAPHVAGLAALVRQAHPDWTVEE
FT                   VKAALVNTASARVVSGDDRTTGLTEATTRVGAGRVDARAAVRTGLLAVVPEDPGAVGVS
FT                   FGTVEAGAPVELTRTVELVNKTGEDLAAVAAYRAATEVPGAEVEVLPRTARVPAGGTAR
FT                   VSVRLRVDPAALRKVGDPTLEVEQRGHARQFLAEVSGRVVFRAGAQDAVLPVYAAPRPV
FT                   SALTARPAPGGVELVGRGLDQGEGAGAYRSLVSAFELHGRSPELPPCGSELLTGCLAAG
FT                   SARGGDLRYAGASAADGVLSFGIATWGTWTGLGAGGTTPVVGVDVDRDGAEDYRVQVAR
FT                   PSDGSGKVVADLWWARTTRVSDDEVVDERPVNGWHGEVDSAVMDSDVLALPVSLEALGV
FT                   ALGDGPVRYRVRTRGWALPAGTEDGVVDRFDGWFDVDPAGSRVALPVGSVARDGLLVPV
FT                   RGAGEVLVLHHHNGGGSRAEVVVYSGE"
     atgagactgc accgccgggc cgcgacggcg gcggcgctgg ccgccgcgct cgccgcgccg        60
     ctcgccccgc tcgggcacgc cgcgcccgac cacccccggc cgcaccgggt caccgcgttc       120
     gtcgagctgg tcggggtgcc cgccgtggac gccgccgcga ccgcgcgcag cgacccgcgc       180
     gaggcggcgc gggcggctcg ggcgcgcacc gggaacaacg ccgacgccgt cctggacgcg       240
     gtgcgctcgg tcgaccgggg cgccgcgcgg gtcggggtga cggtgaacgc ggtgccgggg       300
     gtggtgctca ccgccgagcc cgccgtgctg cgctgggtgg cggggatgcc gcaggtccgg       360
     tcggtgcggc aggcggtgcc caagcgggtg gacaacgcgg gcgcggtgcg gctgaccggc       420
     gcggcggccg tctggcgggc ggtgggaccg tccctccccg gccacggcgg cgcggtggcc       480
     ggggacggtc tgcgcgaggg cctgcgcggc gaggggctgc ggatcggggt ggtcgacacc       540
     ggcgtcgact acacgcacgc cgacttcggc ggctcgggcg ggtacgacga cgtggaccgg       600
     gccggaccgt gggagccgaa cgcgaaggtc gtcggcgggt acgacttcgc gggcgacgac       660
     tacgacgcca acgaccccga gcgcgggacg cccgcccccg acccgaaccc cgtcgactgc       720
     cagggccacg gcacgcacgt cgcgggcacg gccgccgggt acggggtgag cgcggacggg       780
     tccaccttca ccggcgcgca ctccgggctg tccgacgacg acctcgcggc catgcggatc       840
     ggccccggcg ccgcgcccgc cgcgcaggtg tacgcgctga aggtgttcgg ctgcgagggg       900
     tcgacgaacg tggtgtcgca ggcgctcgac tgggcgctcg acccggacgg cgacggcgac       960
     ccctccgacc acctggacgt ggtgaacctg tcgctgggca gcgacttcgg cgcggtggac      1020
     gacccggact cggcgttcgt gcgcaagctc gtgcggcacg gggtggtcgt ggtggcgtcg      1080
     gcgggcaacg cgggcgacct gtacgacgcg ggcgggtcgc cggggagcac gccggaggcg      1140
     gtgaccgtgg cgaacacgcg ggacgcgtcg gtgctgctgg acggggtcgg gctgccgggc      1200
     ggttcggccg aggcgggcgg ttcggacgag ccgggcggtt cggacgaggc gggcggttcg      1260
     gacggggcgg gcggcggcga ggaggtgctg cccggccagt acggcaagga gttcaccggg      1320
     tacgccgacc tggacgtcga gctgcccgtc gcgccggtcg cggacgcggg caacgcggac      1380
     gggtgcgccc cgatcgacca ggacctgtcc gggcggctgg tgtggctgga gtgggacgac      1440
     tcggactcca cccgcgagtg cgggtcggcg gtgcgggcgg accacgcgcg ggacgccggg      1500
     gcggcgggcg cggtgctctc ctccgggcgg accgcgttcg gcgccgggat cgcgggcaac      1560
     gcggacgtcc cgatgttcca gctcaccggg ccggccaccg accgggtgcg cccgctgctc      1620
     gcggacggct cgctgcggct gcgcctggcc gggtcgctgc gcgacgccgc gccgaccgtg      1680
     gtcgagaccc tggccgacac cgtcacgccg tcgtcggcgc gcgggtcgcg gctggcgggc      1740
     ggggcgaagc cggacctggc agcccccggc gacacgatcg tgtccgcgct ggtgggcagc      1800
     gggagcggcg gggtcagcaa gggcgggacg tcgatggccg cgccgcacgt ggccgggctg      1860
     gccgcgctgg tgcggcaggc gcacccggac tggaccgtgg aggaggtcaa ggcggcgctg      1920
     gtgaacaccg cgtccgcgcg ggtggtgtcc ggggacgacc ggacgaccgg gctgaccgag      1980
     gcgaccacgc gggtgggcgc gggccgggtg gacgcgcggg cggcggtgcg gaccgggctg      2040
     ctcgcggtcg tgccggagga ccccggcgcg gtcggggtgt cgttcgggac cgtggaggcg      2100
     ggcgcgccgg tggagctgac ccggaccgtg gagctggtca acaagaccgg ggaggacctg      2160
     gcggcggtgg ccgcctaccg ggccgccacc gaggtgcccg gcgcggaggt cgaggtgctg      2220
     cccaggaccg cgcgggtgcc cgcgggcggc acggcccggg tgtcggtgcg gctgcgggtc      2280
     gacccggccg cgctgcgcaa ggtcggcgac ccgacgctgg aggtcgagca gcgggggcac      2340
     gcgcggcagt tcctggccga ggtgtccggg cgggtggtgt tccgggcggg cgcgcaggac      2400
     gcggtgctgc cggtgtacgc cgcgccccgg ccggtgtcgg cgctgaccgc gcgcccggcg      2460
     cccggcgggg tggagctggt cgggcgcggg ctggaccagg gcgagggggc cggggcctac      2520
     cggtcgctgg tgagcgcgtt cgagctgcac gggcgcagcc cggagctgcc gccgtgcggg      2580
     tcggagctgc tgaccgggtg cctggcggcg gggtcggcgc ggggcggcga cctgcggtac      2640
     gcgggcgcgt cggcggcgga cggggtgctg tcgttcggga tcgcgacgtg ggggacgtgg      2700
     accgggctgg gcgcgggcgg gacgacgccg gtggtgggcg tggacgtgga ccgggacggg      2760
     gccgaggact accgggtgca ggtggcgcgg ccgtccgacg ggagcgggaa ggtcgtcgcg      2820
     gacctgtggt gggcgcgcac cacgcgggtg tccgacgacg aggtggtgga cgagcggccg      2880
     gtcaacgggt ggcacgggga ggtggacagc gcggtgatgg acagcgacgt gctggcgctg      2940
     ccggtgtccc tggaggcgct cggcgtcgcg ctcggggacg ggccggtgcg gtaccgggtg      3000
     cgcacgcgcg ggtgggcgct gcccgccggg accgaggacg gggtggtgga ccgcttcgac      3060
     ggctggttcg acgtcgaccc ggccgggtcg cgggtggcgc tgccggtcgg gtcggtcgcg      3120
     cgggacgggc tgctcgtgcc ggtgcgcggg gcgggcgagg tcctggtgct gcaccaccac      3180
     aacggcggcg gttcccgcgc ggaagtggtg gtttactccg gggaatga                   3228
//

If you have problems or comments...

PBIL Back to PBIL home page