(data stored in ACNUC7421 zone)

EMBL: CP001630.PE386

CP001630.PE386       Location/Qualifiers
FT   CDS_pept        432351..433205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0393"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylatedecarboxylas
FT                   e"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:RL0016 putative FAA hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34360"
FT                   /db_xref="GOA:C6WGP4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP4"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACU34360.1"
FT                   /translation="MQLMRLGEPGSERPAVRADDGTVHDLSGLTADVDGAFLASGGIAR
FT                   ARAALDQGLLPRLAVQGVRVGPPVAGIGKIVCIGLNYRDHADETGQAPPAEPVVFLKAA
FT                   DTVVGPDDEVLLPRRSVKTDWEVELGVVIGRTARYLDSAEEALDHVAGYALSHDVSERE
FT                   FQLERGGQWDKGKSCETFNPLGPFLVPADEVPDPQDLGMRLRVNGLLRQDSSTRRMIFP
FT                   VAELVRYLSWFVVLRPGDLINTGTPAGVALGLPEPKPYLREGDVVELEIDGLGAQRQRV
FT                   GQA"
     gtgcagctga tgcgcctggg ggaaccgggt tccgaacgtc ccgccgtccg cgcggacgac        60
     gggaccgtgc acgacctgag cgggctcacc gccgacgtgg acggcgcctt cctggcgtcc       120
     ggcggcatcg ccagggccag ggccgcgctc gaccagggcc tcctgccgcg cctggcggtc       180
     cagggcgtcc gggtcggccc gccggtcgcg ggcatcggca agatcgtctg catcggcctc       240
     aactaccgcg accacgccga cgagaccggc caggcgccgc ccgccgaacc ggtggtgttc       300
     ctgaaggccg cggacaccgt cgtcggcccg gacgacgagg tgctcctgcc gcgccggtcg       360
     gtcaagaccg actgggaggt cgagctgggc gtcgtgatcg gccgcaccgc ccggtacctg       420
     gacagcgccg aggaggcgct ggaccacgtc gccgggtacg cgctctcgca cgacgtgtcc       480
     gagcgcgagt tccagctgga gcgcggcggg cagtgggaca agggcaagag ctgcgagacg       540
     ttcaaccccc tcggcccctt cctggtgccc gccgacgagg tgcccgaccc gcaggacctc       600
     gggatgcggc tgcgggtcaa cggccttctc cgccaggact cctccacgcg gcgcatgatc       660
     ttcccggtgg ccgagctggt ccgctacctg agctggttcg tcgtcctccg accgggtgac       720
     ctgatcaaca ccggcacgcc cgcgggcgtc gcgctcggcc tgcccgagcc gaagccgtac       780
     ctgcgcgagg gcgacgtggt cgagctggag atcgacggcc tcggcgcgca gcgccagcgc       840
     gtcgggcagg cgtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page