(data stored in ACNUC7421 zone)

EMBL: CP001630.PE387

CP001630.PE387       Location/Qualifiers
FT   CDS_pept        433205..434617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0394"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: xca:xccb100_4271 phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34361"
FT                   /db_xref="GOA:C6WGP5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP5"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACU34361.1"
FT                   /translation="MPTPEPGAPATEPAAPPATRKITVPGGAAPPAAIPPAATITAVDV
FT                   VDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDSGPEGHGLVFTIGRGNDVQAAAIRAL
FT                   APHVVGRPVPEDAAALAALSADLVGDSQIRWLGPEKGVAHMAVGAVVNAAWDLASRRAG
FT                   LPLWRFLSGMSPEELVGLVDFRYLTDALTPDEALTLLRDAQPGRSTRAEELQRCGYPAY
FT                   TTSPGWLGYPDDKLADLAARAVADGFDMIKLKVGADLSDDIRRMGLARSVVGPSVRIAV
FT                   DANQRWDVGAAIGWVRELAPFDPYWVEEPTSPDDVLGHRAIAEAVAPVRVATGEHVANR
FT                   VVFKQLLQAGAVDVVQLDACRVGGVGELLAILLLARKFGVPVCPHAGGVGLCELVRHLA
FT                   MVDYVAVSGSLDGRVLEWVDHLHEHFTDPAVVRDGRYLAPTAPGFSAQLKESSVRDHRY
FT                   PDGPVWAGTGER"
     atgcccacgc cggaaccggg cgcgccagcc accgaacccg ccgccccgcc cgccacccgg        60
     aagatcaccg ttccgggtgg cgcggcccca cctgccgcca tcccgcccgc cgcgaccatc       120
     accgccgtgg acgtggtcga cgtccgcttc cccacctcgc gcgagctcga cggctccgac       180
     gcgatgaacc ccgaccccga ctactccgcc gcctacgtcg tcctgcgcac cgactccggc       240
     cccgagggcc acggcctcgt cttcaccatc ggccggggca acgacgtgca ggccgccgcg       300
     atccgcgcgc tcgccccgca cgtcgtgggc aggcccgtcc ccgaggacgc cgccgcgctc       360
     gccgccctgt ccgccgacct ggtcggcgac tcgcagatcc gctggctggg cccggagaag       420
     ggcgtcgcgc acatggccgt gggcgcggtc gtgaacgccg cctgggacct cgcctcccgc       480
     cgcgcgggcc tgccgctgtg gcggttcctg tcgggcatgt ccccggagga gctggtcggc       540
     ctggtcgact tccgctacct caccgacgcc ctcacccccg acgaggcgct caccctcctg       600
     cgcgacgccc agcccggccg ctccacccgc gccgaggagc tccagcgctg cggctacccc       660
     gcctacacca cctcgcccgg ctggctcggc taccccgacg acaagctcgc cgacctcgcc       720
     gcccgcgcgg tcgccgacgg cttcgacatg atcaagctca aggtcggggc cgacctgtcc       780
     gacgacatcc gccggatggg cctggcccgc tccgtcgtcg gcccgtccgt gcggatcgcc       840
     gtcgacgcca accagcgctg ggacgtgggc gccgcgatcg gctgggtgcg cgagctggcc       900
     ccgttcgacc cgtactgggt ggaggagccc acctcgccgg acgacgtgct cggccaccgc       960
     gccatcgccg aggcggtcgc cccggtccgg gtcgccaccg gcgagcacgt ggccaaccgg      1020
     gtggtgttca agcagctgct ccaggccggg gcggtggacg tggtgcagtt ggacgcctgc      1080
     cgggtcggcg gggtcggcga gctgctcgcg atcctgctgc tggcccgcaa gttcggcgtc      1140
     ccggtgtgcc cgcacgcggg cggcgtcggc ctgtgcgagc tggtgcggca cctggcgatg      1200
     gtcgactacg tcgcggtgtc cggctcgctg gacggccgcg tgctggagtg ggtggaccac      1260
     ctgcacgagc acttcaccga cccggcggtg gtccgcgacg gccgctacct cgcgcccacc      1320
     gcgccgggtt tctccgccca gctcaaggaa tcgtcggtgc gcgaccaccg ctacccggac      1380
     gggccggtgt gggcggggac gggggagcgg tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page