(data stored in ACNUC7421 zone)

EMBL: CP001630.PE388

CP001630.PE388       Location/Qualifiers
FT   CDS_pept        434593..435363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0395"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bpe:BP1923 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34362"
FT                   /db_xref="GOA:C6WGP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34362.1"
FT                   /translation="MGGDGGAVNDFDGLVAAVTGGASGIGLATARLLAGRGAVVYALDL
FT                   DPEVPEPLRGLRTDVADDASVRAALAELTAETGRLDVLVANAGIGAQGDVAAADDAEWL
FT                   RVLDVNVVGVARVVRAALPHLRRSPSAAVVTTGSIAAHAGLPQRAVYSASKGAVHALTL
FT                   AMAADHLREGVRFNAVAPGTADTPWVGRLLASAPDPVAERAALEARQPHGRLVAAEEVA
FT                   AAIAHLASPLSGSTTGTVLAVDGGMHGLRLRPEP"
     gtgggcgggg acgggggagc ggtgaacgac ttcgacgggc tggtggccgc ggtcaccggc        60
     ggggcgtccg gcatcgggct ggccaccgcg cggctgctgg ccgggcgcgg cgcggtggtc       120
     tacgcgctcg acctggaccc cgaggtgccc gagccgctgc gcgggctgcg caccgacgtg       180
     gccgacgacg cctcggtgcg cgcggcgctc gcggagctga ccgccgagac cgggcggctg       240
     gacgtgctgg tggccaacgc ggggatcggc gcgcagggcg acgtggcggc ggccgacgac       300
     gccgagtggc tgcgggtgct ggacgtcaac gtcgtcggcg tcgccagggt ggtccgcgcg       360
     gccctgccgc acctgcgccg ctcgccgtcc gccgccgtcg tcaccaccgg ctcgatcgcc       420
     gcgcacgccg gcctgccgca gcgcgcggtg tactcggcca gcaagggcgc ggtgcacgcg       480
     ctgaccctgg ccatggccgc cgaccacctc cgcgagggcg tccggttcaa cgcggtcgcc       540
     cccggcaccg ccgacacccc gtgggtgggc aggctcctgg cgtcggcccc cgacccggtc       600
     gccgagcggg ccgcgctgga ggccaggcag ccgcacggca ggctcgtggc ggccgaggag       660
     gtggccgccg cgatcgccca cctggccagc ccgctgtccg gctccaccac cgggaccgtg       720
     ctggccgtcg acggcgggat gcacggcctg cggctgcggc cggagccgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page