(data stored in ACNUC7421 zone)

EMBL: CP001630.PE389

CP001630.PE389       Location/Qualifiers
FT   CDS_pept        435360..436289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0396"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xac:XAC4184
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34363"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACU34363.1"
FT                   /translation="MTGAVTGPSRLGFGAAPLGNLYEPVADADAEAAVRAAWEAGVRYY
FT                   DTAPHYGLGLSERRLGAALAGVPRADLVLSTKVGRLLEPVDPVGDDLANGFAVPAHSRR
FT                   VWDFSADGVRRSLESSVDRLGVDRVDVVYLHDPDHHWRQAIDEAYPALADLRDQGVVRA
FT                   VGVGMNQWRVPERFVRETDVDVVLLAGRHTLLERGATGLLDLCAERGVEVVAAAPFNSG
FT                   LLAERVVPDGATHDYAPAPPELLARARALARTCAAHGVDLPAAALQFPLRHPAVRSVLV
FT                   GMRSAAQVRANAAALAAPAPDALWEELA"
     gtgaccggag ccgtgaccgg gccgtcccgc ctcggcttcg gcgccgcgcc gctgggcaac        60
     ctgtacgagc cggtggccga cgcggacgcc gaggccgccg tgcgcgccgc gtgggaggcg       120
     ggcgtgcgct actacgacac cgcgccgcac tacggcctcg gtctgtccga gcggcggctg       180
     ggcgcggcgc tggcgggcgt ccccagggcg gacctcgtgc tgtccaccaa ggtcggcagg       240
     ctcctggagc ccgtcgaccc ggtcggcgac gacctggcca acggcttcgc ggtgcccgcc       300
     cactcccggc gggtgtggga cttcagcgcg gacggcgtcc gccgctccct ggagtcctcg       360
     gtggacaggc tgggcgtgga ccgggtggac gtggtgtacc tgcacgaccc ggaccaccac       420
     tggcggcagg cgatcgacga ggcctacccg gcgttggcgg acctgcgtga ccaaggggtg       480
     gtccgcgccg ttggagtcgg catgaaccag tggcgggttc ccgagcggtt cgtccgcgag       540
     accgacgtgg acgtggtcct cctggccggg cggcacaccc ttctcgaacg cggcgcgacg       600
     ggtctgctcg acctgtgcgc ggagcgcggc gtcgaggtgg tcgccgcggc tcccttcaac       660
     tccggcctcc tggccgagcg cgtcgtcccg gacggggcga cccacgacta cgcccccgcg       720
     ccgcccgagc tgctggcgcg ggccagggcg ctggcgcgga cgtgcgccgc gcacggcgtc       780
     gacctgcccg cggcggcgct ccagttcccc ctgcggcacc cggcggtccg ctcggtgctg       840
     gtggggatgc gctcggccgc gcaggtccgc gccaacgccg ccgcgctcgc cgcgcccgcg       900
     ccggacgcgc tgtgggagga gctcgcgtga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page