(data stored in ACNUC7421 zone)

EMBL: CP001630.PE39

CP001630.PE39        Location/Qualifiers
FT   CDS_pept        43715..43996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34013"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34013.1"
FT                   /translation="MLGTRRRRAKRALDAARMLDEVVDTQLPLLASFDEERRRRSADYL
FT                   AELVKLAQDYRYFANGWIDARELDRRGQEALVVLGKFRNDPTARLAQD"
     ttgctcggca ctaggcgcag gcgcgccaag cgggccctcg acgcggccag gatgctggac        60
     gaggtcgtcg acacgcagtt gccgctgctg gcctcgttcg acgaggagcg gcggcggcgg       120
     tccgcggact acctcgcgga gctggtgaag ctcgcccagg actaccgcta cttcgccaac       180
     ggctggatcg acgcccgcga gctcgaccgg cgcgggcagg aggcgctggt ggtgctcggg       240
     aagttccgca acgacccgac cgccaggctc gcgcaggact ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page